Q9SXZ2 · FT_ARATH
- ProteinProtein FLOWERING LOCUS T
- GeneFT
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids175 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the mobile flower-promoting signal (floral stimulus or florigen). Promotes the transition from vegetative growth to flowering. Required for 'SEPALLATA3' (SEP3) and 'FRUITFULL' (FUL) accumulation in mature rosette leaves. Seems to acts in parallel with 'LEAFY' to induce flowering by regulating 'APETALA1'. Translated in leaves and then transported to the shoot apical meristem where it activates the transcription of several floral meristem identity genes. May play a role in both the autonomous and the long-day flowering pathways.
Miscellaneous
Mutagenesis of Tyr-85 to His converts the activator of flowering 'FLOWERING LOCUS T' into a 'TERMINAL FLOWER 1'-like repressor of flowering.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | nucleus | |
Molecular Function | phosphatidylethanolamine binding | |
Biological Process | cell differentiation | |
Biological Process | flower development | |
Biological Process | meristem determinacy | |
Biological Process | photoperiodism, flowering | |
Biological Process | positive regulation of flower development | |
Biological Process | regulation of flower development | |
Biological Process | regulation of stomatal movement |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein FLOWERING LOCUS T
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SXZ2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 84 | In ft-4; late-flowering. | ||||
Sequence: E → K | ||||||
Mutagenesis | 85 | Inhibition of terminal flower formation, but weak effect on flowering time. | ||||
Sequence: Y → H | ||||||
Mutagenesis | 94 | In ft-6; late-flowering. | ||||
Sequence: P → L | ||||||
Mutagenesis | 110 | No effect on terminal flower formation. | ||||
Sequence: N → M | ||||||
Mutagenesis | 119 | In ft-3; late-flowering. | ||||
Sequence: R → H | ||||||
Mutagenesis | 120 | No effect on terminal flower formation. | ||||
Sequence: V → F | ||||||
Mutagenesis | 171 | In ft-1; late-flowering. | ||||
Sequence: G → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000204762 | 1-175 | Protein FLOWERING LOCUS T | |||
Sequence: MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL |
Proteomic databases
Expression
Tissue specificity
Mostly localized in leaves vasculature.
Induction
Levels follow a circadian cycle with a progressive accumulation during the day time (PubMed:25343985).
By light. Expression is delayed and reduced under SD conditions. Repressed by FLC. Up-Regulated by VOZ1 and/or VOZ2 (PubMed:22904146).
Up-regulated by APL/FE (PubMed:26239308).
Down-regulated by the H3K36me2 modification at the FT locus produced by the interaction between EFM and JMJ30 (PubMed:25132385).
Repressed by MYB56 (PubMed:25343985).
By light. Expression is delayed and reduced under SD conditions. Repressed by FLC. Up-Regulated by VOZ1 and/or VOZ2 (PubMed:22904146).
Up-regulated by APL/FE (PubMed:26239308).
Down-regulated by the H3K36me2 modification at the FT locus produced by the interaction between EFM and JMJ30 (PubMed:25132385).
Repressed by MYB56 (PubMed:25343985).
Developmental stage
Expression gradually increases with time under both long-day (LD) and short-day (SD) photoperiods. Under LD conditions, expression is first detected on day 4 and plateaued around day 6, preceeding floral commitment around days 9 and 10.
Gene expression databases
Interaction
Subunit
Interacts with FD/BZIP14 and FDP/BZIP27 (PubMed:16099979, PubMed:16099980).
Interacts with FTIP1/MCTP1 in phloem companion cells (PubMed:22529749, PubMed:29259105).
Interacts with NAKR1 (PubMed:27255839).
Interacts with FTIP1/MCTP1 in phloem companion cells (PubMed:22529749, PubMed:29259105).
Interacts with NAKR1 (PubMed:27255839).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9SXZ2 | FD Q84JK2 | 4 | EBI-636490, EBI-636507 | |
BINARY | Q9SXZ2 | HDG6 Q9FVI6 | 2 | EBI-636490, EBI-1393271 |
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9SXZ2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length175
- Mass (Da)19,809
- Last updated2001-12-05 v2
- ChecksumE4051B22CE66D508
Q9SXZ2-2
- NameShort
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8AMK0 | A0A1P8AMK0_ARATH | FT | 219 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB027504 EMBL· GenBank· DDBJ | BAA77838.1 EMBL· GenBank· DDBJ | mRNA | ||
AB027505 EMBL· GenBank· DDBJ | BAA77839.1 EMBL· GenBank· DDBJ | mRNA | ||
AF152096 EMBL· GenBank· DDBJ | AAF03936.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC001229 EMBL· GenBank· DDBJ | AAB60904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE34381.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY065378 EMBL· GenBank· DDBJ | AAL38819.1 EMBL· GenBank· DDBJ | mRNA | ||
AY133813 EMBL· GenBank· DDBJ | AAM91747.1 EMBL· GenBank· DDBJ | mRNA |