Q9SXQ6 · FEN11_ORYSJ
- ProteinFlap endonuclease 1-A
- GeneFEN1A
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids380 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structures that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA (By similarity).
May be required for cell proliferation
May be required for cell proliferation
Cofactor
Note: Binds 2 magnesium ions per subunit. They probably participate in the reaction catalyzed by the enzyme. May bind an additional third magnesium ion after substrate binding.
Activity regulation
Inhibited by NaCl.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 34 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 71 | DNA (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 87 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 159 | DNA (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 159 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 161 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 180 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 182 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 232 | DNA (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 234 | DNA (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 234 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Molecular Function | 5'-3' exonuclease activity | |
Molecular Function | 5'-flap endonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | magnesium ion binding | |
Biological Process | base-excision repair | |
Biological Process | DNA replication, removal of RNA primer |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFlap endonuclease 1-A
- EC number
- Short namesFEN-1-A
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ9SXQ6
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Resides mostly in the nucleoli and relocalizes to the nucleoplasm upon DNA damage.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000154071 | 1-380 | UniProt | Flap endonuclease 1-A | |||
Sequence: MGIKGLTKLLADNAPKAMKEQKFESYFGRRIAVDASMSIYQFLIVVGRTGMETLTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSKREDATKELTEAVEEGDKDAIEKFSKRTVKVTKQHNEECKRLLRLMGVPVVEAPCEAEAECAALCINDMVYAVASEDMDSLTFGAPRFLRHLMDPSSKKIPVMEFEVAKVLEELELTMDQFIDLCILSGCDYCDSIKGIGGQTALKLIRQHGSIESILENINKDRYQIPEDWPYQEARRLFKEPNVTLDIPELKWNAPDEEGLVEFLVKENGFNQDRVTKAIEKIKFAKNKSSQGRLESFFKPVVSTSVPLKRKDTSEKPTKAVANKKTKGAGGKKK | |||||||
Modified residue (large scale data) | 342 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated. Phosphorylation upon DNA damage induces relocalization to the nuclear plasma.
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Strongly expressed in proliferating tissues: root and shoot apical meristem, tiller bud, leaf, ligule primordia, marginal meristem of young leaves and panicles. Not expressed in mature leaves when exposed to UV.
Induction
Induced by gamma irradiation.
Gene expression databases
Interaction
Subunit
Interacts with PCNA. Three molecules of FEN1 bind to one PCNA trimer with each molecule binding to one PCNA monomer. PCNA stimulates the nuclease activity without altering cleavage specificity.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-105 | N-domain | ||||
Sequence: MGIKGLTKLLADNAPKAMKEQKFESYFGRRIAVDASMSIYQFLIVVGRTGMETLTNEAGEVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSKR | ||||||
Region | 123-254 | I-domain | ||||
Sequence: AIEKFSKRTVKVTKQHNEECKRLLRLMGVPVVEAPCEAEAECAALCINDMVYAVASEDMDSLTFGAPRFLRHLMDPSSKKIPVMEFEVAKVLEELELTMDQFIDLCILSGCDYCDSIKGIGGQTALKLIRQH | ||||||
Region | 336-344 | Interaction with PCNA | ||||
Sequence: SQGRLESFF | ||||||
Region | 351-380 | Disordered | ||||
Sequence: SVPLKRKDTSEKPTKAVANKKTKGAGGKKK |
Sequence similarities
Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length380
- Mass (Da)42,792
- Last updated2000-05-01 v1
- ChecksumE0148AAFA95A7364
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0WPM2 | A0A0P0WPM2_ORYSJ | Os05g0540100 | 225 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB021666 EMBL· GenBank· DDBJ | BAA36171.1 EMBL· GenBank· DDBJ | mRNA | ||
AC119291 EMBL· GenBank· DDBJ | AAV59413.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP008211 EMBL· GenBank· DDBJ | BAF18093.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014961 EMBL· GenBank· DDBJ | BAS95109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000142 EMBL· GenBank· DDBJ | EEE64530.1 EMBL· GenBank· DDBJ | Genomic DNA |