Q9SXE9 · CCAP1_ARATH
- ProteinCytosolic calcium-binding protein 1
- GeneCCaP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids152 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds calcium Ca2+ and may act as a signal mediator to buffer Ca2+.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | calcium ion binding | |
Biological Process | abscisic acid-activated signaling pathway | |
Biological Process | cellular response to gibberellin stimulus | |
Biological Process | cellular response to sucrose starvation | |
Biological Process | response to absence of light | |
Biological Process | response to calcium ion | |
Biological Process | response to light stimulus | |
Biological Process | response to mannitol | |
Biological Process | response to metal ion | |
Biological Process | response to salt | |
Biological Process | response to sorbitol | |
Biological Process | response to sucrose |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytosolic calcium-binding protein 1
- Short namesCytosolic Ca(2+)-binding protein 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SXE9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000458762 | 1-152 | Cytosolic calcium-binding protein 1 | |||
Sequence: MATIEVEQVTPVAAENIEVPPPKAVESEEVTTVSESLPAPVTESQAPVEVTTKDLVVEETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE |
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in petioles (at protein level) (PubMed:17145720).
Mainly observed in shoots, flowers, siliques and roots, and, to a lower extent, in stems and leaves (PubMed:17145720).
Mainly observed in shoots, flowers, siliques and roots, and, to a lower extent, in stems and leaves (PubMed:17145720).
Induction
Levels follow a circadian cycle with higher levels during the night and lower levels in light phases (PubMed:17145720).
Accumulates in darkness within 24 hours, but repressed by light and the product of photosynthesis (e.g. sucrose) (at protein level) (PubMed:17145720).
Induced by sucrose depletion, but activated by mannitol and sorbitol (PubMed:17145720).
Triggered by gibberellic acid (GA) and salt stresses (e.g. NaCl and KCl) (PubMed:17145720).
Suppressed by a high concentration of calcium Ca2+ and of other metal ions (PubMed:17145720).
Accumulates in darkness within 24 hours, but repressed by light and the product of photosynthesis (e.g. sucrose) (at protein level) (PubMed:17145720).
Induced by sucrose depletion, but activated by mannitol and sorbitol (PubMed:17145720).
Triggered by gibberellic acid (GA) and salt stresses (e.g. NaCl and KCl) (PubMed:17145720).
Suppressed by a high concentration of calcium Ca2+ and of other metal ions (PubMed:17145720).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 57-62 | 1 | ||||
Sequence: VEETEK | ||||||
Region | 57-136 | 7 X 5 AA approximate repeats of V-E-E-K-K | ||||
Sequence: VEETEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKKPEAEEEK | ||||||
Region | 60-152 | Disordered | ||||
Sequence: TEKPIEETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKKPEAEEEKPAVEASVTAPVEKADE | ||||||
Repeat | 67-71 | 2 | ||||
Sequence: TEEAQ | ||||||
Compositional bias | 74-138 | Basic and acidic residues | ||||
Sequence: TPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKKPEAEEEKPA | ||||||
Repeat | 78-82 | 3 | ||||
Sequence: VEIKK | ||||||
Repeat | 104-108 | 4 | ||||
Sequence: VEAKK | ||||||
Repeat | 112-116 | 5 | ||||
Sequence: VEEKK | ||||||
Repeat | 124-129 | 6 | ||||
Sequence: VEEEKK | ||||||
Repeat | 131-136 | 7 | ||||
Sequence: EAEEEK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9SXE9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length152
- Mass (Da)16,628
- Last updated2000-05-01 v1
- Checksum2A750BC986C6F1E1
Q9SXE9-2
- Name2
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 4 | in Ref. 5; AAM63945 | ||||
Sequence: I → V | ||||||
Alternative sequence | VSP_061965 | 66-117 | in isoform 2 | |||
Sequence: ETEEAQVETPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKT → QNRGSCRGEERGRSRRKEDRGSSSGCGGREEARGRGGETRRGSLRDSSSGEG | ||||||
Compositional bias | 74-138 | Basic and acidic residues | ||||
Sequence: TPEVVEIKKDEEAPVETPVVVEDESKTEEVVEAKKEEEVEEKKTEEAPVVVEEEKKPEAEEEKPA | ||||||
Alternative sequence | VSP_061966 | 118-152 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005698 EMBL· GenBank· DDBJ | AAD43605.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE33970.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY074862 EMBL· GenBank· DDBJ | AAL75884.1 EMBL· GenBank· DDBJ | mRNA | ||
AY097383 EMBL· GenBank· DDBJ | AAM19899.1 EMBL· GenBank· DDBJ | mRNA | ||
AK318727 EMBL· GenBank· DDBJ | BAH56842.1 EMBL· GenBank· DDBJ | mRNA | ||
AY086900 EMBL· GenBank· DDBJ | AAM63945.1 EMBL· GenBank· DDBJ | mRNA |