Q9SWA6 · SNI1_ARATH
- ProteinNegative regulator of systemic acquired resistance SNI1
- GeneSNI1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids432 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination (PubMed:24207055).
Transcription repressor that prevents expression of pathogenesis-related genes (PR) via histone modifications and binding negative cis-acting elements at their promoters (PubMed:16766691, PubMed:17369431, PubMed:20935179, PubMed:21320694).
Negative regulator of hypersensitive response (HR) and systemic acquired resistance (SAR) required to dampen the basal expression of pathogenesis related (PR) genes (PubMed:10458608, PubMed:16766691, PubMed:17360504, PubMed:21149701).
Functions synergistically with NTL9/CBNAC as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae (PubMed:22826500).
Binds to the PR1 gene promoter to suppress defense response in the absence of pathogen challenge and is removed in response to induction (PubMed:21320694, PubMed:22826500).
Negatively regulates both gene expression and DNA recombination during pathogen infection, thus being involved in short-term defense response and a long-term survival strategy (PubMed:17360504).
Prevents effective immune responses that involve activation of DNA damage responses, probably by negatively regulating the DNA damage sensors RAD17 and ATR (PubMed:24207055).
Negative regulator of defenses against the beet cyst nematode H.schachtii (PubMed:18321188).
Transcription repressor that prevents expression of pathogenesis-related genes (PR) via histone modifications and binding negative cis-acting elements at their promoters (PubMed:16766691, PubMed:17369431, PubMed:20935179, PubMed:21320694).
Negative regulator of hypersensitive response (HR) and systemic acquired resistance (SAR) required to dampen the basal expression of pathogenesis related (PR) genes (PubMed:10458608, PubMed:16766691, PubMed:17360504, PubMed:21149701).
Functions synergistically with NTL9/CBNAC as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae (PubMed:22826500).
Binds to the PR1 gene promoter to suppress defense response in the absence of pathogen challenge and is removed in response to induction (PubMed:21320694, PubMed:22826500).
Negatively regulates both gene expression and DNA recombination during pathogen infection, thus being involved in short-term defense response and a long-term survival strategy (PubMed:17360504).
Prevents effective immune responses that involve activation of DNA damage responses, probably by negatively regulating the DNA damage sensors RAD17 and ATR (PubMed:24207055).
Negative regulator of defenses against the beet cyst nematode H.schachtii (PubMed:18321188).
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | Smc5-Smc6 complex | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | chromatin remodeling | |
Biological Process | defense response to nematode | |
Biological Process | DNA damage response | |
Biological Process | DNA repair | |
Biological Process | negative regulation of defense response | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of systemic acquired resistance | |
Biological Process | plant-type hypersensitive response | |
Biological Process | somatic cell DNA recombination | |
Biological Process | systemic acquired resistance |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNegative regulator of systemic acquired resistance SNI1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SWA6
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Also detectable in some fluorescent loci peripheral to the nucleus.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Accumulation of DNA damage leading to constitutively activated DNA damage responses (DDR) (PubMed:24207055).
Increased basal expression of pathogenesis-related (PR) genes (e.g. PR1) and hypersensitive response (HR) (PubMed:16766691, PubMed:17360504, PubMed:17369431, PubMed:20935179, PubMed:21149701, PubMed:21320694).
Chromatin modifications at the PR-1 promoter that mimic induction (e.g. AcH3 and MeH3K4) (PubMed:16766691).
Dwarf plants with distorted leaves, reduced root length, early flowering and reduced fertility (PubMed:16766691, PubMed:17360504, PubMed:21320694).
Decreased susceptibility to the beet cyst nematode H.schachtii (PubMed:18321188).
Mutant plants display enhanced resistance to the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:22826500).
Constitutively elevated levels of somatic homologous recombination (PubMed:17360504).
Suppressor of the npr1-1 mutant phenotypes, including systemic acquired resistance (SAR) and normal levels of PR1 restoration (PubMed:10458608, PubMed:20935179).
Increased basal expression of pathogenesis-related (PR) genes (e.g. PR1) and hypersensitive response (HR) (PubMed:16766691, PubMed:17360504, PubMed:17369431, PubMed:20935179, PubMed:21149701, PubMed:21320694).
Chromatin modifications at the PR-1 promoter that mimic induction (e.g. AcH3 and MeH3K4) (PubMed:16766691).
Dwarf plants with distorted leaves, reduced root length, early flowering and reduced fertility (PubMed:16766691, PubMed:17360504, PubMed:21320694).
Decreased susceptibility to the beet cyst nematode H.schachtii (PubMed:18321188).
Mutant plants display enhanced resistance to the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:22826500).
Constitutively elevated levels of somatic homologous recombination (PubMed:17360504).
Suppressor of the npr1-1 mutant phenotypes, including systemic acquired resistance (SAR) and normal levels of PR1 restoration (PubMed:10458608, PubMed:20935179).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 59 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438367 | 1-432 | Negative regulator of systemic acquired resistance SNI1 | |||
Sequence: MSKETKGNNNTSRVMSGYGGSLEANTLAMIDSTGAKDSRDANEDRLQYLEAVRAASLVPENGIPPTNKMYQAIFRILRFGKTLELITASFQLLTQLHQRFPWVYVSDSADQLDIVDEAWSPFNFGSDVDSDEKDLSVRSLFLQQLIQNMNKRVNESEESDLKILGNMFLFKYLAHVLKLDFTPRNQVYEETMNWSLLKESFLNLLLASRKVNFKLLMKDYLSTMCASIDADEKSISLVELHKDMLTAMKELLVMIMELDTSKKKADLEGITSRGDGVRTPAMEIILDELTYDGYLLSKFLQVFDDPKWKLEIVLQYLTKYIPKPVVRTRRTTVPQAEDSKTLNGILKTFSNGTNPKNITKKIGPDIVQILIGHAFLARLTFSDPHEGDSISEICSSIISAFTSLKRVDQKIEILPFGKEVLFTAGMVLKAKA |
Proteomic databases
Expression
Interaction
Structure
Sequence
- Sequence statusComplete
- Length432
- Mass (Da)48,812
- Last updated2000-05-01 v1
- Checksum2A577F53213B0C3D
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 142 | in Ref. 5; AAM60892 | ||||
Sequence: L → F | ||||||
Sequence conflict | 362 | in Ref. 5; AAM60892 | ||||
Sequence: I → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF169596 EMBL· GenBank· DDBJ | AAD50900.1 EMBL· GenBank· DDBJ | mRNA | ||
AL021710 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002687 EMBL· GenBank· DDBJ | AEE84048.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT029212 EMBL· GenBank· DDBJ | ABJ17147.1 EMBL· GenBank· DDBJ | mRNA | ||
AY084302 EMBL· GenBank· DDBJ | AAM60892.1 EMBL· GenBank· DDBJ | mRNA |