Q9STS6 · LBD27_ARATH
- ProteinLOB domain-containing protein 27
- GeneLBD27
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids328 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Biological Process | microsporogenesis | |
Biological Process | pollen development | |
Biological Process | regulation of asymmetric cell division |
Names & Taxonomy
Protein names
- Recommended nameLOB domain-containing protein 27
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9STS6
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000132278 | 1-328 | LOB domain-containing protein 27 | |||
Sequence: MSNTKHIHKGLQERLLDLLLIALIVYMTLKGGTSGACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILEKLDETQKPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWFAEEELKAVNSQLQLYRSQPQNGQNQNQNHNHNQMIHELGSDHNKQQEDVTSQQLDLGMGLNVNNNQSNVVTPFFSSLLPVSETQQPQMSYTYSCSEVNNNGYSPPAYNTDSGKEILTNNNNVWGDQNRFLYNNNNGGGYSNQNESCHEMKSNGVMAIQSQLVNLQMVSNHQRVEEEEADHEYDELHQFLDIIDDRQSFGDSKEA |
Proteomic databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9STS6 | TGA1 Q39237 | 3 | EBI-15209584, EBI-541351 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-136 | LOB | ||||
Sequence: GACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILEKLDETQKPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWFAEEELKAVNSQL |
Sequence similarities
Belongs to the LOB domain-containing protein family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length328
- Mass (Da)37,334
- Last updated2000-05-01 v1
- Checksum3DC982C9806C1D3D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB473862 EMBL· GenBank· DDBJ | BAH10573.1 EMBL· GenBank· DDBJ | mRNA | ||
AL049746 EMBL· GenBank· DDBJ | CAB41870.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78342.1 EMBL· GenBank· DDBJ | Genomic DNA |