Q9STF9 · THA8L_ARATH
- ProteinProtein THYLAKOID ASSEMBLY 8-like, chloroplastic
- GeneTHA8L
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids257 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds weakly to specific single strand RNA (ssRNA).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | sequence-specific mRNA binding | |
Molecular Function | single-stranded RNA binding | |
Molecular Function | zinc ion binding |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProtein THYLAKOID ASSEMBLY 8-like, chloroplastic
- Short namesAtTHA8L
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9STF9
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 75 | Abolished RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 86 | Reduced RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 93 | Reduced RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 96 | Reduced RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 104 | Abolished RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 119 | Abolished RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 155 | Abolished RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 157 | Reduced RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 158 | Reduced RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 186 | Reduced RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 190 | Reduced RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 206 | Reduced RNA binding. | ||||
Sequence: K → E | ||||||
Mutagenesis | 217 | Reduced RNA binding. | ||||
Sequence: R → E | ||||||
Mutagenesis | 221 | Reduced RNA binding. | ||||
Sequence: K → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 29 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-55 | Chloroplast | ||||
Sequence: MTAIRVCSRKFPTFASIFFQNITRNPSIHRISFSNLKPKTLLHPIPPKPFTVFVS | ||||||
Chain | PRO_0000356125 | 56-257 | Protein THYLAKOID ASSEMBLY 8-like, chloroplastic | |||
Sequence: RFHDGRPRGPLWRGKKLIGKEALFVILGLKRLKEDDEKLDKFIKTHVFRLLKLDMLAVIGELERQEETALAIKMFEVIQKQEWYQPDVFMYKDLIVSLAKSKRMDEAMALWEKMKKENLFPDSQTYTEVIRGFLRDGCPADAMNVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEEIFGRC |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 142-176 | PPR 1 | ||||
Sequence: DVFMYKDLIVSLAKSKRMDEAMALWEKMKKENLFP | ||||||
Repeat | 177-211 | PPR 2 | ||||
Sequence: DSQTYTEVIRGFLRDGCPADAMNVYEDMLKSPDPP |
Sequence similarities
Belongs to the PPR family. P subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length257
- Mass (Da)30,133
- Last updated2000-05-01 v1
- ChecksumC6D3D8189362F7F7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LSM9 | A0A1I9LSM9_ARATH | At3g46870 | 269 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL096859 EMBL· GenBank· DDBJ | CAB51178.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78213.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK117833 EMBL· GenBank· DDBJ | BAC42475.1 EMBL· GenBank· DDBJ | mRNA | ||
BT005267 EMBL· GenBank· DDBJ | AAO63331.1 EMBL· GenBank· DDBJ | mRNA |