Q9ST99 · PROF2_TOBAC
- ProteinProfilin-2
- GenePRO2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids134 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cytoskeleton | |
Molecular Function | actin monomer binding | |
Biological Process | sequestering of actin monomers |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProfilin-2
- Alternative names
- Allergen nameNic t 8
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Nicotianoideae > Nicotianeae > Nicotiana
Accessions
- Primary accessionQ9ST99
Proteomes
Subcellular Location
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 114 | Loss of phosphorylation. | ||||
Sequence: T → A |
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for initiator methionine, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000199675 | 2-134 | Profilin-2 | |||
Sequence: SWQTYVDDHLMADIEGQQGNHLAAAAILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEPGHLAPTGLFLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY | ||||||
Modified residue | 114 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylated by MAP kinases.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length134
- Mass (Da)14,489
- Last updated2000-05-01 v1
- ChecksumB05615420DBDF21E
Keywords
- Technical term