Q9SSW0 · AZF3_ARATH
- ProteinZinc finger protein AZF3
- GeneAZF3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids193 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Transcriptional repressor probably involved in abiotic stress responses. Binds DNA in a sequence-specific manner and can repress the transactivation activity of other transcription factors.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | metal ion binding | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | hyperosmotic salinity response | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | response to cold |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein AZF3
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SSW0
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000421828 | 1-193 | Zinc finger protein AZF3 | |||
Sequence: MALEALNSPRLVEDPLRFNGVEQWTKCKKRSKRSRSDLHHNHRLTEEEYLAFCLMLLARDGGDLDSVTVAEKPSYKCGVCYKTFSSYQALGGHKASHRSLYGGGENDKSTPSTAVKSHVCSVCGKSFATGQALGGHKRCHYDGGVSNSEGVGSTSHVSSSSHRGFDLNIIPVQGFSPDDEVMSPMATKKPRLK |
Proteomic databases
Expression
Tissue specificity
Expressed in roots.
Induction
By abscisic acid (ABA), ethylene, salt, cold and heat.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9SSW0 | ARR15 Q7G8V2 | 2 | EBI-1807790, EBI-1100967 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 75-97 | C2H2-type 1 | ||||
Sequence: YKCGVCYKTFSSYQALGGHKASH | ||||||
Zinc finger | 118-140 | C2H2-type 2 | ||||
Sequence: HVCSVCGKSFATGQALGGHKRCH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length193
- Mass (Da)21,020
- Last updated2000-05-01 v1
- ChecksumDE67FEB17AAA51CA
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 70 | in Ref. 5; AAM67193 | ||||
Sequence: A → E | ||||||
Sequence conflict | 105 | in Ref. 5; AAM67193 | ||||
Sequence: E → D | ||||||
Sequence conflict | 170 | in Ref. 5; AAM67193 | ||||
Sequence: I → L | ||||||
Sequence conflict | 177 | in Ref. 5; AAM67193 | ||||
Sequence: P → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB030732 EMBL· GenBank· DDBJ | BAA85109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB008267 EMBL· GenBank· DDBJ | BAB08281.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED94918.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT024582 EMBL· GenBank· DDBJ | ABD42980.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088887 EMBL· GenBank· DDBJ | AAM67193.1 EMBL· GenBank· DDBJ | mRNA |