Q9SRR0 · PEX13_ARATH
- ProteinPeroxisomal membrane protein 13
- GenePEX13
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids304 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor (PubMed:16813573, PubMed:17478547, PubMed:19594707).
The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm (By similarity).
Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix (By similarity).
Essential for pollen-tube discharge that take place only in the presence of functional peroxisomes in either the male or the female gametophyte (PubMed:18160292).
The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm (By similarity).
Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix (By similarity).
Essential for pollen-tube discharge that take place only in the presence of functional peroxisomes in either the male or the female gametophyte (PubMed:18160292).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | peroxisomal membrane | |
Biological Process | fatty acid beta-oxidation | |
Biological Process | protein import into peroxisome matrix | |
Biological Process | protein import into peroxisome matrix, docking |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePeroxisomal membrane protein 13
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SRR0
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Peroxisome membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Lethal, when homozygous.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 263-304 | In apm2; reduced protein transport to peroxisome and repressed plant growth. | ||||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000403359 | 1-304 | Peroxisomal membrane protein 13 | |||
Sequence: MASQPAGGSPPKPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAANMNSLSRPVPARPWEQQNYGSTMGGGYGSNLGMTSGYGSGTYGSALGGYGSSYGGGMYGGSSMYRGGYGGGGLYGSSGMYGGGAMGGYGGTMGGYGMGMGTGMGMGMGMGMGGPYGSQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGMLYGELARFVLRMLGVRTRPRKMQQPPQGPNGLPLPHQPHGNQNYLEGPKTAAPGGGGGWDNVWGN |
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in pollen. Detected in shoots, roots, stems, leaves, inflorescences and emasculated postils. Strongly expressed in both male and female gametophytes during fertilization.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-78 | Disordered | ||||
Sequence: MASQPAGGSPPKPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAANMNSLSRPVPARPWEQQ | ||||||
Compositional bias | 23-41 | Polar residues | ||||
Sequence: PNPFRPPSNTSTAGSVEAS | ||||||
Region | 258-304 | Disordered | ||||
Sequence: PRKMQQPPQGPNGLPLPHQPHGNQNYLEGPKTAAPGGGGGWDNVWGN |
Sequence similarities
Belongs to the peroxin-13 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9SRR0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length304
- Mass (Da)31,286
- Last updated2000-05-01 v1
- Checksum246722710D2D3D6C
Q9SRR0-2
- Name2
- Differences from canonical
- 130-293: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 23-41 | Polar residues | ||||
Sequence: PNPFRPPSNTSTAGSVEAS | ||||||
Alternative sequence | VSP_040377 | 130-293 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009853 EMBL· GenBank· DDBJ | AAF02160.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE74561.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY075689 EMBL· GenBank· DDBJ | AAL77696.1 EMBL· GenBank· DDBJ | mRNA | ||
AY093745 EMBL· GenBank· DDBJ | AAM10369.1 EMBL· GenBank· DDBJ | mRNA | ||
AK318837 EMBL· GenBank· DDBJ | BAH56952.1 EMBL· GenBank· DDBJ | mRNA |