Q9SNB9 · TRP2_ARATH
- ProteinTelomere repeat-binding protein 2
- GeneTRP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids553 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds specifically to the plant telomeric double-stranded DNA sequences. At least 2 repeats of telomeric sequences are required for binding. Induces DNA bending.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 476-503 | H-T-H motif | ||||
Sequence: WRDVKVRAFEDADHRTYVDLKDKWKTLV |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding, bending | |
Molecular Function | telomeric DNA binding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTelomere repeat-binding protein 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SNB9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype, probably due to redundancy.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 85 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000394125 | 1-553 | Telomere repeat-binding protein 2 | |||
Sequence: MVSHKVLEFGDDGYKLPAQARAPRSLRKKRIYEKKIPGDDKMCAIDLLATVAGSLLLESKSPVNACLVVQNTVKNEYPADENPVKAVPYSESPSLFDNGKCGFSSVITNPNHLLVGDKVGKEVEGFSSLGVSGDVKPDVVASIGSNSSTEVGACGNGSPNESRDDVNLFSRNDDDENFSGYIRTRMTRPVPRIGDRRIRKILASRHWKGGSKNNTDAKPWYCSKRSYYLHHHQRSYPIKKRKYFDSVYDSNSDDYRLQGKTHKGSRTISSMKSRNASFVSRDHHVKLRIKSFRVPELFVEIPETATVGSLKRMVMEAVTTILGDGLRVGLMVQGKKVRDDGKTLLQTGISEENNHLDSLGFSLEPSLETTPQPLLSSYLSDHACDDVTLCHDNALDSSHEPEPSPADSFGKLGTSDHSRALIPVASAAMLAPRPPNRKFKRTEQQLAAQRRIRRPFSVTEVEALVQAVEKLGTGRWRDVKVRAFEDADHRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLKAHAYWSQHLMHQLQTEPPSTQVEAL |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed ubiquitously. Highest expression in flowers and leaves.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 147-165 | Polar residues | ||||
Sequence: SSTEVGACGNGSPNESRDD | ||||||
Region | 147-170 | Disordered | ||||
Sequence: SSTEVGACGNGSPNESRDDVNLFS | ||||||
Domain | 285-364 | Ubiquitin-like | ||||
Sequence: VKLRIKSFRVPELFVEIPETATVGSLKRMVMEAVTTILGDGLRVGLMVQGKKVRDDGKTLLQTGISEENNHLDSLGFSLE | ||||||
Region | 394-413 | Disordered | ||||
Sequence: ALDSSHEPEPSPADSFGKLG | ||||||
Domain | 448-507 | HTH myb-type | ||||
Sequence: AQRRIRRPFSVTEVEALVQAVEKLGTGRWRDVKVRAFEDADHRTYVDLKDKWKTLVHTAR |
Domain
The Myb-extension domain (509-540) is necessary and sufficient for telomere binding.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9SNB9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length553
- Mass (Da)61,775
- Last updated2000-05-01 v1
- Checksum92C4C2D9DB252594
Q9SNB9-2
- Name2
- Differences from canonical
- 28-28: Missing
Q9SNB9-3
- Name3
- Differences from canonical
- 210-215: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LN24 | A0A1I9LN24_ARATH | TRFL1 | 397 | ||
A0A1I9LN25 | A0A1I9LN25_ARATH | TRFL1 | 512 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL133314 EMBL· GenBank· DDBJ | CAB62329.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78175.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78176.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78177.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK229705 EMBL· GenBank· DDBJ | BAF01544.1 EMBL· GenBank· DDBJ | mRNA | ||
AY062489 EMBL· GenBank· DDBJ | AAL32567.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AY090966 EMBL· GenBank· DDBJ | AAM14002.1 EMBL· GenBank· DDBJ | mRNA | ||
AY519541 EMBL· GenBank· DDBJ | AAS10011.1 EMBL· GenBank· DDBJ | mRNA | ||
AY568647 EMBL· GenBank· DDBJ | AAS79537.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ630475 EMBL· GenBank· DDBJ | CAG25848.1 EMBL· GenBank· DDBJ | mRNA | ||
AY395985 EMBL· GenBank· DDBJ | AAR28946.1 EMBL· GenBank· DDBJ | mRNA | ||
BT033142 EMBL· GenBank· DDBJ | ACF40322.1 EMBL· GenBank· DDBJ | mRNA |