Q9SJX8 · MYB14_ARATH
- ProteinTranscription factor MYB14
- GeneMYB14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids249 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 37-61 | H-T-H motif | ||||
Sequence: WRALPKHAGLLRCGKSCRLRWINYL | ||||||
DNA binding | 89-112 | H-T-H motif | ||||
Sequence: WSAIAAKLPGRTDNEIKNVWHTHL |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | response to cold | |
Biological Process | response to freezing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor MYB14
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SJX8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Increased tolerance to freezing stress and higher accumulation of CBF genes and downstream genes under cold treatment.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 17 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438896 | 1-249 | Transcription factor MYB14 | |||
Sequence: MGRAPCCEKMGVKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINYLRPDIKRGNFTPQEEQTIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLSKNLNNGGDTKDVNGINETTNEDKGSVIVDTASLQQFSNSITTFDISNDNKDDIMSYEDISALIDDSFWSDVISVDNSNKNEKKIEDWEGLIDRNSKKCSYSNSKLYNDDMEFWFDVFTSNRRIEEFSDIPEF |
Proteomic databases
Expression
Tissue specificity
Expressed in imbibed seeds, hypocotyls, cotyledons, roots, seedlings, siliques and flowers.
Induction
Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103).
Down-regulated by cold treatment (PubMed:24415840).
Down-regulated by cold treatment (PubMed:24415840).
Developmental stage
Fades out in old roots and leaves.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-61 | HTH myb-type 1 | ||||
Sequence: KMGVKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINYL | ||||||
Domain | 62-116 | HTH myb-type 2 | ||||
Sequence: RPDIKRGNFTPQEEQTIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL | ||||||
Motif | 198-205 | Nuclear localization signal | ||||
Sequence: EKKIEDWE |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length249
- Mass (Da)28,769
- Last updated2000-05-01 v1
- Checksum91AE28FF0414EE81
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY519575 EMBL· GenBank· DDBJ | AAS10045.1 EMBL· GenBank· DDBJ | mRNA | ||
AC005311 EMBL· GenBank· DDBJ | AAM15030.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC006593 EMBL· GenBank· DDBJ | AAD20663.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC08504.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT024853 EMBL· GenBank· DDBJ | ABD60736.1 EMBL· GenBank· DDBJ | mRNA | ||
AF062865 EMBL· GenBank· DDBJ | AAC83587.1 EMBL· GenBank· DDBJ | mRNA |