Q9SD82 · RFA1B_ARATH
- ProteinReplication protein A 70 kDa DNA-binding subunit B
- GeneRPA1B
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids604 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. The activity of RPA is mediated by single-stranded DNA binding and protein interactions (By similarity).
Probably involved in repair of double-strand DNA breaks (DSBs) induced by genotoxic stresses (By similarity).
Probably involved in repair of double-strand DNA breaks (DSBs) induced by genotoxic stresses (By similarity).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 170-256 | OB | ||||
Sequence: WTIKVRVTNKGVMRTYKNARGEGCVFNVELTDEEGTQIQATMFNAAARKFYDRFEMGKVYYISRGSLKLANKQFKTVQNDYEMTLNE |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | DNA replication | |
Biological Process | response to UV-B |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameReplication protein A 70 kDa DNA-binding subunit B
- Short namesAtRPA70B
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SD82
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions, but mutant plants have increased sensitivity to genotoxic stresses and agents that damage DNA bases (UV and methyl methanesulfonate, MMS).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 43 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000422616 | 1-604 | Replication protein A 70 kDa DNA-binding subunit B | |||
Sequence: MENSVTQDGIATVLANQSLDSSSVRPEIVVQVVDLKPAGNRYTFSANDGKMKIKAMLPATLTSDIISGKIQNLGLIRLLEYTVNDIPGKSEEKYMLITKCEAVASALDSEIKAEIKASTGIMLKPKHEFVAKSASQIINEQRGNAAPAARMAMTRRVHPLVSLNPYQGSWTIKVRVTNKGVMRTYKNARGEGCVFNVELTDEEGTQIQATMFNAAARKFYDRFEMGKVYYISRGSLKLANKQFKTVQNDYEMTLNENSEVEEASNEEMFTPETKFNFVPIDELGTYVNQKDLIDVIGVVQSVSPTMSIRRKNDNEMIPKRDITLADETKKTVVVSLWNDLATGIGQELLDMADNHPVIAIKSLKVGAFQGVSLSTISRSNVVINPNSPEATKLKSWYDAEGKETSMSAIGSGMSSSANNGSRSMYSDRVFLSHITSNPSLGEEKPVFFSTRAYISFIKPDQTMWYRACKTCNKKVTEAMDSGYWCESCQKKDQECSLRYIMAVKVSDSTGETWLSAFNDEAEKIIGCTADDLNDLKSEEGEVNEFQTKLKEATWSSHLFRISVSQQEYNSEKRQRITVRGVSPIDFAAETRLLLQDISKNKTSQ |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 468-488 | C4-type | ||||
Sequence: CKTCNKKVTEAMDSGYWCESC |
Sequence similarities
Belongs to the replication factor A protein 1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length604
- Mass (Da)67,289
- Last updated2000-05-01 v1
- Checksum6DB6B37424843D47
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL133421 EMBL· GenBank· DDBJ | CAB62614.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91235.1 EMBL· GenBank· DDBJ | Genomic DNA |