Q9S7I3 · NLTP2_ARATH
- ProteinNon-specific lipid-transfer protein 2
- GeneLTP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids118 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | endosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | plant-type cell wall | |
Cellular Component | plasma membrane | |
Cellular Component | trans-Golgi network | |
Molecular Function | lipid binding | |
Biological Process | cuticle development | |
Biological Process | phospholipid transfer to membrane | |
Biological Process | plant epidermal cell differentiation | |
Biological Process | regulation of cutin biosynthetic process | |
Biological Process | response to water deprivation |
Keywords
- Biological process
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameNon-specific lipid-transfer protein 2
- Short namesLTP 2
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9S7I3
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MAGVMKLACMVLACMIVAGPITANA | ||||||
Chain | PRO_0000018362 | 26-118 | Non-specific lipid-transfer protein 2 | |||
Sequence: LMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR | ||||||
Disulfide bond | 29↔76 | |||||
Sequence: CGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRC | ||||||
Disulfide bond | 39↔53 | |||||
Sequence: CIAYLTRGAPLTQGC | ||||||
Disulfide bond | 54↔100 | |||||
Sequence: CNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSAC | ||||||
Disulfide bond | 74↔114 | |||||
Sequence: CRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNC |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length118
- Mass (Da)11,938
- Last updated2000-05-01 v1
- Checksum88490E003188B6AC
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 69 | in Ref. 8; CAA79122 | ||||
Sequence: D → N |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF057357 EMBL· GenBank· DDBJ | AAC24829.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF159799 EMBL· GenBank· DDBJ | AAF76928.1 EMBL· GenBank· DDBJ | mRNA | ||
AB238795 EMBL· GenBank· DDBJ | BAE46870.1 EMBL· GenBank· DDBJ | mRNA | ||
AC005499 EMBL· GenBank· DDBJ | AAC67365.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09546.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY059927 EMBL· GenBank· DDBJ | AAL24409.1 EMBL· GenBank· DDBJ | mRNA | ||
AY081562 EMBL· GenBank· DDBJ | AAM10124.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085800 EMBL· GenBank· DDBJ | AAM63016.1 EMBL· GenBank· DDBJ | mRNA | ||
Z17770 EMBL· GenBank· DDBJ | CAA79060.1 EMBL· GenBank· DDBJ | mRNA | ||
Z17787 EMBL· GenBank· DDBJ | CAA79068.1 EMBL· GenBank· DDBJ | mRNA | ||
Z18168 EMBL· GenBank· DDBJ | CAA79122.1 EMBL· GenBank· DDBJ | mRNA |