Q9RR44 · GBUC_LISM4
- ProteinGlycine betaine/carnitine transport binding protein GbuC
- GenegbuC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids300 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Part of the ABC transporter complex GbuABC involved in glycine betaine uptake. Involved, with BetL and OpuC, in osmoprotection and cryoprotection of Listeria. Can also uptake carnitine when carnitine is abundant in the growth medium.
Activity regulation
The complex is activated by an osmotic gradient or by low temperature.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ATP-binding cassette (ABC) transporter complex | |
Molecular Function | carnitine transmembrane transporter activity | |
Biological Process | amino acid transport | |
Biological Process | carnitine transport | |
Biological Process | glycine betaine transport | |
Biological Process | response to cold | |
Biological Process | response to osmotic stress |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGlycine betaine/carnitine transport binding protein GbuC
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Listeriaceae > Listeria
Accessions
- Primary accessionQ9RR44
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MLKKLITTAVLAMLIFTLAA | ||||||
Lipidation | 21 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 21 | S-diacylglycerol cysteine | ||||
Sequence: C | ||||||
Chain | PRO_0000417960 | 21-300 | Glycine betaine/carnitine transport binding protein GbuC | |||
Sequence: CGTTLAPYDAKKDLGEQINYTITGIDAGAGIMLATQNAIKDYHLDDDNWQLQTSSTAAMTSTLQKAMKDKRPIVVTGWTPHWMFTKFDLKFLDDPKNVYGNAENIHTIVRKGLKEDKPSAYQVLDNFFWTAEDMSEVMLEVNDGVDPEEAAKKWIKNNPDKVAKWTDGVEKVDGDEIKLTYVAWDSEIASTNVVAEALKQVGYKPTIQAMEIQPMWASVATDAADGMVAAWLPNTSGIYYKDYKGKFEDLGPNLKGAKIGLAVPKYMTNINSIEDLKTSK |
Keywords
- PTM
Interaction
Subunit
The complex is composed of two ATP-binding proteins (GbuA), two transmembrane proteins (GbuB) and a solute-binding protein (GbuC).
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length300
- Mass (Da)33,276
- Last updated2012-07-11 v2
- Checksum0EEE78317C41301E
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 266 | in Ref. 1; AAD29106 | ||||
Sequence: K → N |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF039835 EMBL· GenBank· DDBJ | AAD29106.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002002 EMBL· GenBank· DDBJ | AEO06016.1 EMBL· GenBank· DDBJ | Genomic DNA |