Q9R803 · SCTB2_SALTY
- ProteinSPI-2 type 3 secretion system translocon protein SctB
- GenesctB2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the type III secretion system 2 (SPI-2 T3SS), also called injectisome, which is used to inject bacterial effector proteins into eukaryotic host cells (Probable). SseC/SctE2 and SseD/SctB2 are inserted into the host membrane where they form a pore and allow the translocation of effector proteins into the cytosol of target cells (Probable).
Required for the translocation of SPI-2 effector proteins (PubMed:11567004).
Required for systemic Salmonella infection of the mouse (PubMed:11159962).
Essential for SpvB-induced actin depolymerization in the host cell cytoplasm (PubMed:18248436).
Required for systemic Salmonella infection of the mouse (PubMed:11159962).
Essential for SpvB-induced actin depolymerization in the host cell cytoplasm (PubMed:18248436).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | extracellular region | |
Cellular Component | host cell membrane | |
Cellular Component | membrane | |
Biological Process | protein secretion by the type III secretion system |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSPI-2 type 3 secretion system translocon protein SctB
- Short namesSPI-2 T3SS translocon protein SctB
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionQ9R803
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Host membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 90-110 | Helical | ||||
Sequence: MITAGGAMLSGVLTIGLGAVG | ||||||
Transmembrane | 115-135 | Helical | ||||
Sequence: LIAGQAVGHTAGGVMGLGAGV | ||||||
Transmembrane | 170-190 | Helical | ||||
Sequence: EIMQQIIGVGSSLVTVLAEIL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Disruption prevents SpvB-induced F-actin depolymerization in human macrophages without affecting intra-bacterial SpvB protein levels.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000391717 | 1-195 | SPI-2 type 3 secretion system translocon protein SctB | |||
Sequence: MEASNVALVLPAPSLLTPSSTPSPSGEGMGTESMLLLFDDIWMKLMELAKKLRDIMRSYNVEKQRLAWELQVNVLQTQMKTIDEAFRASMITAGGAMLSGVLTIGLGAVGGETGLIAGQAVGHTAGGVMGLGAGVAQRQSDQDKAIADLQQNGAQSYNKSLTEIMEKATEIMQQIIGVGSSLVTVLAEILRALTR |
Proteomic databases
Interaction
Subunit
The core secretion machinery of the T3SS is composed of approximately 20 different proteins, including cytoplasmic components, a base, an export apparatus and a needle (PubMed:30107569).
This subunit is involved in the formation of a pore, called the translocon, in host membrane (Probable). May form a complex with SseB and SseC/SctE2 (PubMed:11567004).
SseB is required for correct localization of SseD/SctB2 on the bacterial cell surface (PubMed:11567004).
Binds to the chaperone SseA (PubMed:12724372, PubMed:15256549).
This subunit is involved in the formation of a pore, called the translocon, in host membrane (Probable). May form a complex with SseB and SseC/SctE2 (PubMed:11567004).
SseB is required for correct localization of SseD/SctB2 on the bacterial cell surface (PubMed:11567004).
Binds to the chaperone SseA (PubMed:12724372, PubMed:15256549).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9R803 | sseA O84944 | 2 | EBI-2272067, EBI-2030631 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length195
- Mass (Da)20,592
- Last updated2000-05-01 v1
- Checksum45F95BBEB726D837
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 153 | in Ref. 2; AAC28882 | ||||
Sequence: G → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ224892 EMBL· GenBank· DDBJ | CAA12188.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF020808 EMBL· GenBank· DDBJ | AAC28882.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE006468 EMBL· GenBank· DDBJ | AAL20325.1 EMBL· GenBank· DDBJ | Genomic DNA |