Q9QXZ9 · OPN4_MOUSE
- ProteinMelanopsin
- GeneOpn4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids521 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Photoreceptor that binds cis-retinaldehydes (PubMed:19793992).
Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light (PubMed:12808468).
May be involved in the optokinetic visual tracking response (PubMed:26392540).
May be involved in the regulation of retinal hyaloid vessel growth and regression (PubMed:30936473).
Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light (PubMed:12808468).
May be involved in the optokinetic visual tracking response (PubMed:26392540).
May be involved in the regulation of retinal hyaloid vessel growth and regression (PubMed:30936473).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dendrite | |
Cellular Component | membrane | |
Cellular Component | perikaryon | |
Cellular Component | plasma membrane | |
Cellular Component | sperm head plasma membrane | |
Molecular Function | 11-cis retinal binding | |
Molecular Function | G protein-coupled photoreceptor activity | |
Biological Process | cellular response to light stimulus | |
Biological Process | detection of temperature stimulus involved in thermoception | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | hyaloid vascular plexus regression | |
Biological Process | optokinetic behavior | |
Biological Process | phototransduction | |
Biological Process | regulation of circadian rhythm | |
Biological Process | retina development in camera-type eye | |
Biological Process | rhythmic process | |
Biological Process | thermotaxis | |
Biological Process | visual perception |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMelanopsin
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9QXZ9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-71 | Extracellular | ||||
Sequence: MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYT | ||||||
Transmembrane | 72-92 | Helical; Name=1 | ||||
Sequence: LGTVILLVGLTGMLGNLTVIY | ||||||
Topological domain | 93-106 | Cytoplasmic | ||||
Sequence: TFCRNRGLRTPANM | ||||||
Transmembrane | 107-127 | Helical; Name=2 | ||||
Sequence: FIINLAVSDFLMSVTQAPVFF | ||||||
Topological domain | 128-143 | Extracellular | ||||
Sequence: ASSLYKKWLFGETGCE | ||||||
Transmembrane | 144-164 | Helical; Name=3 | ||||
Sequence: FYAFCGAVFGITSMITLTAIA | ||||||
Topological domain | 165-187 | Cytoplasmic | ||||
Sequence: MDRYLVITRPLATIGRGSKRRTA | ||||||
Transmembrane | 188-208 | Helical; Name=4 | ||||
Sequence: LVLLGVWLYALAWSLPPFFGW | ||||||
Topological domain | 209-237 | Extracellular | ||||
Sequence: SAYVPEGLLTSCSWDYMTFTPQVRAYTML | ||||||
Transmembrane | 238-258 | Helical; Name=5 | ||||
Sequence: LFCFVFFLPLLIIIFCYIFIF | ||||||
Topological domain | 259-293 | Cytoplasmic | ||||
Sequence: RAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAK | ||||||
Transmembrane | 294-314 | Helical; Name=6 | ||||
Sequence: VALIVILLFVLSWAPYSTVAL | ||||||
Topological domain | 315-329 | Extracellular | ||||
Sequence: VAFAGYSHILTPYMS | ||||||
Transmembrane | 330-350 | Helical; Name=7 | ||||
Sequence: SVPAVIAKASAIHNPIIYAIT | ||||||
Topological domain | 351-521 | Cytoplasmic | ||||
Sequence: HPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mice fail to show a pupillar reflex, photoentrainment of the circadian clock and other non-image forming responses to light (PubMed:12808468).
Newborn mice show normal hyaloid vessel numbers and normal vessel cellularity, however vessel numbers are increased by P8 (PubMed:30936473).
In Opn4 and Pde6b double knockout mice optokinetic visual tracking response is abolished (PubMed:26392540).
Newborn mice show normal hyaloid vessel numbers and normal vessel cellularity, however vessel numbers are increased by P8 (PubMed:30936473).
In Opn4 and Pde6b double knockout mice optokinetic visual tracking response is abolished (PubMed:26392540).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000197816 | 1-521 | Melanopsin | |||
Sequence: MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL | ||||||
Glycosylation | 30 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 34 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 142↔220 | |||||
Sequence: CEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSC | ||||||
Modified residue | 337 | N6-(retinylidene)lysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the retinal pigment epithelium and ganglion cell layer (at protein level) (PubMed:10632589, PubMed:30240620, PubMed:31607531).
Also expressed in amacrine cell layers of the retina (PubMed:10632589).
Weakly expressed in vibrissae, and tail (PubMed:31607531).
Also expressed in amacrine cell layers of the retina (PubMed:10632589).
Weakly expressed in vibrissae, and tail (PubMed:31607531).
Isoform 1
Observed with processes in the outer strata of inner plexiform layer (IPL) close to the inner nuclear layer (INL) or is found to be bistratified with processes located both in the inner (ON) or outer (OFF) layers of the IPL (at protein level) (PubMed:19793992).
A second population of isoform 1 is identified in processes which are confined to the inner layer of the IPL near to the ganglion cell layer (GCL) (at protein level) (PubMed:19793992).
A second population of isoform 1 is identified in processes which are confined to the inner layer of the IPL near to the ganglion cell layer (GCL) (at protein level) (PubMed:19793992).
Isoform 2
About 40 times more abundant than isoform 1 in the retina (at protein level) (PubMed:19793992).
Isoform 2 is involved in processes localized to the outer IPL or is bistratified with processes in both the inner and outer layers of the IPL (at protein level) (PubMed:19793992).
Isoform 2 is absent in the processes confined only to the inner layer of the IPL (at protein level) (PubMed:19793992).
Isoform 2 is involved in processes localized to the outer IPL or is bistratified with processes in both the inner and outer layers of the IPL (at protein level) (PubMed:19793992).
Isoform 2 is absent in the processes confined only to the inner layer of the IPL (at protein level) (PubMed:19793992).
Developmental stage
Expressed in the inner retina at postnatal day 5 (P5), and expressed in retinal ganglion cells at P12.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 445-463 | Polar residues | ||||
Sequence: GELKASSSPQVQRSKTPKV | ||||||
Region | 445-486 | Disordered | ||||
Sequence: GELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQ |
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Protein family/group databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9QXZ9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsOpn4L
- Length521
- Mass (Da)57,231
- Last updated2000-05-01 v1
- Checksum50FD1CBB05669DA9
Q9QXZ9-2
- Name2
- SynonymsOpn4S
- Differences from canonical
- 455-521: VQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL → TKGHLPSLDLGM
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 445-463 | Polar residues | ||||
Sequence: GELKASSSPQVQRSKTPKV | ||||||
Alternative sequence | VSP_045928 | 455-521 | in isoform 2 | |||
Sequence: VQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL → TKGHLPSLDLGM |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF147789 EMBL· GenBank· DDBJ | AAF24979.1 EMBL· GenBank· DDBJ | mRNA | ||
EU303117 EMBL· GenBank· DDBJ | ACA01962.1 EMBL· GenBank· DDBJ | mRNA | ||
EU303118 EMBL· GenBank· DDBJ | ACA01963.1 EMBL· GenBank· DDBJ | mRNA | ||
AC114543 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC139827 EMBL· GenBank· DDBJ | AAI39828.1 EMBL· GenBank· DDBJ | mRNA |