Q9QXV3 · ING1_MOUSE
- ProteinInhibitor of growth protein 1
- GeneIng1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids279 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.
Features
Showing features for site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 212 | Histone H3K4me3 binding | ||||
Sequence: Y | ||||||
Binding site | 213 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 215 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Site | 223 | Histone H3K4me3 binding | ||||
Sequence: M | ||||||
Binding site | 226 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Site | 227 | Histone H3K4me3 binding | ||||
Sequence: D | ||||||
Binding site | 231 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Site | 235 | Histone H3K4me3 binding | ||||
Sequence: W | ||||||
Binding site | 237 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 240 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 253 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 256 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | Sin3-type complex | |
Molecular Function | metal ion binding | |
Molecular Function | methylated histone binding | |
Biological Process | negative regulation of cell migration | |
Biological Process | negative regulation of stem cell population maintenance | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | negative regulation of transforming growth factor beta receptor signaling pathway | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of stem cell population maintenance | |
Biological Process | protein import into nucleus | |
Biological Process | regulation of programmed cell death |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameInhibitor of growth protein 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9QXV3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000212662 | 1-279 | Inhibitor of growth protein 1 | |||
Sequence: MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRETDGTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR | ||||||
Cross-link | 135 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In the adult, widely expressed with highest levels in thymus and testis.
Developmental stage
Expressed throughout the whole embryo at all stages of development examined. At day 10, highest expression is found in the yolk sac while at day 16 and 18, higher levels are found in inner compartments of bone. In the embryo, highest expression of isoform 1 is found at day 11 while highest expression of isoform 2 is found at day 7.
Gene expression databases
Interaction
Subunit
Interacts with H3K4me3 and to a lesser extent with H3K4me2. Isoform 2 interacts with RSL1D1.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 115-206 | Disordered | ||||
Sequence: AHQDISDGTGGSGKAGQDKSKSEAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPID | ||||||
Compositional bias | 137-179 | Basic and acidic residues | ||||
Sequence: EAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEK | ||||||
Zinc finger | 210-259 | PHD-type | ||||
Sequence: PTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE | ||||||
Region | 262-279 | PBR | ||||
Sequence: KTMDKALEKSKKERAYNR |
Domain
The PHD-type zinc finger mediates the binding to H3K4me3.
The polybasic region (PBR) is responsive to the binding to phosphoinositides (PtdInsPs), including phosphatidylinositol 5-phosphate (PtdIns5P).
Sequence similarities
Belongs to the ING family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9QXV3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonyms1b, p37
- Length279
- Mass (Da)32,109
- Last updated2000-05-01 v1
- Checksum6765C984EEF179F4
Q9QXV3-2
- Name2
- Synonyms1a, 1c, p31
- Differences from canonical
- 1-94: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1B0GSP9 | A0A1B0GSP9_MOUSE | Ing1 | 77 | ||
A0A1B0GT89 | A0A1B0GT89_MOUSE | Ing1 | 161 |
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_050378 | 1-94 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 137-179 | Basic and acidic residues | ||||
Sequence: EAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEK | ||||||
Sequence conflict | 203 | in Ref. 2; AAF09183 | ||||
Sequence: L → F |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF177753 EMBL· GenBank· DDBJ | AAF16911.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF177755 EMBL· GenBank· DDBJ | AAF16908.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177756 EMBL· GenBank· DDBJ | AAF16909.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177757 EMBL· GenBank· DDBJ | AAF16910.1 EMBL· GenBank· DDBJ | mRNA | ||
AF149820 EMBL· GenBank· DDBJ | AAF09183.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016573 EMBL· GenBank· DDBJ | AAH16573.1 EMBL· GenBank· DDBJ | mRNA | ||
BC147770 EMBL· GenBank· DDBJ | AAI47771.1 EMBL· GenBank· DDBJ | mRNA | ||
BC147784 EMBL· GenBank· DDBJ | AAI47785.1 EMBL· GenBank· DDBJ | mRNA |