Q9QXN3 · TRIP4_MOUSE
- ProteinActivating signal cointegrator 1
- GeneTrip4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids581 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription coactivator which associates with nuclear receptors, transcriptional coactivators including EP300, CREBBP and NCOA1, and basal transcription factors like TBP and TFIIA to facilitate nuclear receptors-mediated transcription. May thereby play an important role in establishing distinct coactivator complexes under different cellular conditions. Plays a role in thyroid hormone receptor and estrogen receptor transactivation (By similarity).
Also involved in androgen receptor transactivation (PubMed:12077347).
Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. May play a role in the development of neuromuscular junction (By similarity).
May play a role in late myogenic differentiation (PubMed:27008887).
Also functions as part of the RQC trigger (RQT) complex that activates the ribosome quality control (RQC) pathway, a pathway that degrades nascent peptide chains during problematic translation (By similarity).
Also involved in androgen receptor transactivation (PubMed:12077347).
Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. May play a role in the development of neuromuscular junction (By similarity).
May play a role in late myogenic differentiation (PubMed:27008887).
Also functions as part of the RQC trigger (RQT) complex that activates the ribosome quality control (RQC) pathway, a pathway that degrades nascent peptide chains during problematic translation (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | activating signal cointegrator 1 complex | |
Cellular Component | centrosome | |
Cellular Component | cytosol | |
Cellular Component | neuromuscular junction | |
Cellular Component | nuclear body | |
Cellular Component | nucleus | |
Cellular Component | RQC-trigger complex | |
Molecular Function | histone acetyltransferase binding | |
Molecular Function | nuclear estrogen receptor binding | |
Molecular Function | nuclear receptor binding | |
Molecular Function | protease binding | |
Molecular Function | protein kinase binding | |
Molecular Function | transcription coactivator activity | |
Molecular Function | ubiquitin-like protein ligase binding | |
Molecular Function | zinc ion binding | |
Biological Process | estrogen receptor signaling pathway | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | regulation of myoblast differentiation | |
Biological Process | rescue of stalled ribosome | |
Biological Process | ribosome disassembly | |
Biological Process | ribosome-associated ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameActivating signal cointegrator 1
- Short namesASC-1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9QXN3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Cytoplasmic under conditions of serum deprivation. Colocalizes with NEK6 in the centrosome.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000065632 | 2-581 | Activating signal cointegrator 1 | |||
Sequence: AVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDEILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAKAQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSLVCTNEEQDILQRDSNKSQKLLKKLMSGAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYHSRLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQWVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQFPDISQESDSSFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV | ||||||
Modified residue | 276 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 289 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Cross-link | 324 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1) | ||||
Sequence: K | ||||||
Cross-link | 334 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1) | ||||
Sequence: K |
Post-translational modification
Phosphorylated by NEK6.
Polyufmylated by the UFM1-conjugating system composed of the enzymes UBA5, UFC1 and UFL1. Deufmylated by the protease UFSP2. Ufmylation of TRIP4 is promoted by ligand-bound nuclear receptors that compete with UFSP2 for interaction with TRIP4. Nuclear receptors-induced ufmylation promotes the recruitment of additional transcriptional coactivators like EP300 and NCOA1 and therefore the assembly of a coactivator complex facilitating nuclear receptor-mediated transcription.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed (PubMed:12390891).
Expressed in the spinal cord, brain, paraspinal ganglia, thyroid, and submandibular glands (PubMed:26924529).
Expressed at low level in all the muscles (at protein level) but with higher expression in axial than in limb muscles (PubMed:27008887).
Expressed in the spinal cord, brain, paraspinal ganglia, thyroid, and submandibular glands (PubMed:26924529).
Expressed at low level in all the muscles (at protein level) but with higher expression in axial than in limb muscles (PubMed:27008887).
Developmental stage
Expressed in 17.5-day-old embryos.
Gene expression databases
Interaction
Subunit
Interacts with the thyroid hormone receptor/TR (via the ligand-binding domain); this interaction requires the presence of thyroid hormone (By similarity).
Interacts with the androgen receptor/AR; in an androgen, testosterone and dihydrotestosterone-dependent manner (By similarity).
Interacts with ESR1 (estrogen ligand-bound); competes with UFSP2 (By similarity).
Interacts with UFSP2; competes with ligand-bound ESR1 (By similarity).
Interacts with DDRGK1 and UFL1; the interaction with DDRGK1 is direct (By similarity).
Interacts with NCOA1 (By similarity).
Interacts with EP300 (By similarity).
Part of the ASC-1 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3 (PubMed:12077347).
Identified in the RQT (ribosome quality control trigger) complex, that contains ASCC2, ASCC3 and TRIP4 (By similarity).
Interacts with NEK6 (By similarity).
Interacts with CSRP1 (By similarity).
Interacts with ZCCHC4 (By similarity).
Interacts with the androgen receptor/AR; in an androgen, testosterone and dihydrotestosterone-dependent manner (By similarity).
Interacts with ESR1 (estrogen ligand-bound); competes with UFSP2 (By similarity).
Interacts with UFSP2; competes with ligand-bound ESR1 (By similarity).
Interacts with DDRGK1 and UFL1; the interaction with DDRGK1 is direct (By similarity).
Interacts with NCOA1 (By similarity).
Interacts with EP300 (By similarity).
Part of the ASC-1 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3 (PubMed:12077347).
Identified in the RQT (ribosome quality control trigger) complex, that contains ASCC2, ASCC3 and TRIP4 (By similarity).
Interacts with NEK6 (By similarity).
Interacts with CSRP1 (By similarity).
Interacts with ZCCHC4 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, zinc finger, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 100-121 | Disordered | ||||
Sequence: DQLKRSRRKGRNKQEVPAFPEP | ||||||
Zinc finger | 167-219 | C4-type | ||||
Sequence: GRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSLVCTNEEQDILQRD | ||||||
Region | 200-300 | Mediates interaction with DDRGK1 | ||||
Sequence: CLFCGSLVCTNEEQDILQRDSNKSQKLLKKLMSGAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSK | ||||||
Region | 300-400 | Mediates interaction with UFL1 | ||||
Sequence: KVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYHSRLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQWVDNTGSTPQ | ||||||
Compositional bias | 390-407 | Polar residues | ||||
Sequence: QWVDNTGSTPQKKTSLSA | ||||||
Region | 390-410 | Disordered | ||||
Sequence: QWVDNTGSTPQKKTSLSAGPR | ||||||
Domain | 437-531 | ASCH | ||||
Sequence: LSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQFPDISQ |
Domain
The C4-type zinc finger mediates a competitive interaction with UFSP2 and ligand-bound nuclear receptors. It also mediates interaction with the transcriptional coactivators and the basal transcription machinery.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9QXN3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length581
- Mass (Da)66,197
- Last updated2011-07-27 v2
- Checksum2CAB3512E3CEDDA7
Q9QXN3-2
- Name2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D3Z3P3 | D3Z3P3_MOUSE | Trip4 | 56 |
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 7 | in Ref. 3; BAC30209 | ||||
Sequence: A → G | ||||||
Sequence conflict | 388 | in Ref. 1; AAF18440, 2; AAN23117 and 5; AAH21316 | ||||
Sequence: S → P | ||||||
Compositional bias | 390-407 | Polar residues | ||||
Sequence: QWVDNTGSTPQKKTSLSA | ||||||
Alternative sequence | VSP_011109 | 526-539 | in isoform 2 | |||
Sequence: FPDISQESDSSFVF → GNWIPRSIKEQRRG | ||||||
Alternative sequence | VSP_011110 | 540-581 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF197574 EMBL· GenBank· DDBJ | AAF18440.1 EMBL· GenBank· DDBJ | mRNA | ||
AF539614 EMBL· GenBank· DDBJ | AAN23117.1 EMBL· GenBank· DDBJ | mRNA | ||
AK039024 EMBL· GenBank· DDBJ | BAC30209.1 EMBL· GenBank· DDBJ | mRNA | ||
AC151906 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC021316 EMBL· GenBank· DDBJ | AAH21316.1 EMBL· GenBank· DDBJ | mRNA |