Q9Q2Q3 · POL2_BBWV2
- ProteinRNA2 polyprotein
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1065 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
VP53
Acts as a suppressor of post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25173697).
Binds ssRNA (PubMed:25173697).
Binds ssRNA (PubMed:25173697).
Movement protein
Transports the viral genome to neighboring plant cells directly through plasmosdesmata, without any budding (PubMed:19463725).
The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (PubMed:19463725).
Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (PubMed:20832435, PubMed:26903400).
Binds to GTP and to single-stranded RNA and single-stranded DNA in a non-sequence-specific manner (PubMed:12021864).
Also acts as a suppressor of post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25173697).
The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (PubMed:19463725).
Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (PubMed:20832435, PubMed:26903400).
Binds to GTP and to single-stranded RNA and single-stranded DNA in a non-sequence-specific manner (PubMed:12021864).
Also acts as a suppressor of post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25173697).
Large capsid protein
Together with the small capsid protein, forms an icosahedral capsid (T=3) enclosing the viral positive strand RNA genome, with a diameter of approximately 300 Angstroms (By similarity).
The large capsid protein interacts with the viral RNA (By similarity).
Also acts as a suppressor of post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25173697).
Binds ssRNA (PubMed:25173697).
The large capsid protein interacts with the viral RNA (By similarity).
Also acts as a suppressor of post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25173697).
Binds ssRNA (PubMed:25173697).
Small capsid protein
Together with the large capsid protein, forms an icosahedral capsid (T=3) enclosing the viral positive strand RNA genome, with a diameter of approximately 300 Angstroms (By similarity).
The capsid is formed from 60 copies each of the large and the small capsid protein. The small capsid protein forms the turrets at the fivefold axes of the viral particle (By similarity).
The capsid is formed from 60 copies each of the large and the small capsid protein. The small capsid protein forms the turrets at the fivefold axes of the viral particle (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 466-467 | Cleavage; by viral protease | ||||
Sequence: QG | ||||||
Site | 868-869 | Cleavage; by viral protease | ||||
Sequence: QA |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum | |
Cellular Component | host cell plasmodesma | |
Cellular Component | T=3 icosahedral viral capsid | |
Molecular Function | DNA binding | |
Molecular Function | RNA binding | |
Molecular Function | structural molecule activity | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | transport of virus in host, cell to cell | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRNA2 polyprotein
- Alternative names
- Cleaved into 4 chains
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Picornavirales > Secoviridae > Comovirinae > Fabavirus > Fabavirus betaviciae
Accessions
- Primary accessionQ9Q2Q3
- Secondary accessions
Subcellular Location
UniProt Annotation
GO Annotation
Movement protein
Note: Assembles in tubules that are embedded within modified plasmodesmata.
Large capsid protein
Small capsid protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000445864 | 1-466 | VP53 | |||
Sequence: MRPELVAVLDRYFSEIISCFFLGWLLNFLLVWFCSTKSTFLLWSVFLYICYYILRIEFAYIVAPFLKTIYTNSSQYHTVDWAYAYTALPKGLWEQITDYNYCYNFPPPRVEGFVSDFSPRFTLKELEIMNEANITPVHTIPKDTLLKRASDYKLAVESKKSILPRVQDLYEMDKWHNLRSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPVVEKYTEEVADDRLPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRASGVPSHVIYFPMHRVPACDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEKVTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNAQQTEAITTDRGILFPKPKFKGNEVVLNYTGSGKIRNVGSQRFETKKNATGEQFVRSVDDLGCLSDEDGKDYRYGQ | ||||||
Chain | PRO_0000445863 | 1-1065 | RNA2 polyprotein | |||
Sequence: MRPELVAVLDRYFSEIISCFFLGWLLNFLLVWFCSTKSTFLLWSVFLYICYYILRIEFAYIVAPFLKTIYTNSSQYHTVDWAYAYTALPKGLWEQITDYNYCYNFPPPRVEGFVSDFSPRFTLKELEIMNEANITPVHTIPKDTLLKRASDYKLAVESKKSILPRVQDLYEMDKWHNLRSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPVVEKYTEEVADDRLPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRASGVPSHVIYFPMHRVPACDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEKVTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNAQQTEAITTDRGILFPKPKFKGNEVVLNYTGSGKIRNVGSQRFETKKNATGEQFVRSVDDLGCLSDEDGKDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKFAPVVVIQTLSKWLNAPKVDARISFAIYYEPTVVLPKQIATLEHAPAFMFRKEVGTLAFKQGERVAYSFEVNLGKPQTDGKEVTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDISFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQAHATPKDFSSVRFVMGHWKYRAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLLQNCAWMRGTLRFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSFSREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDTVVLYGQFDSNVEFAGQRKGGHYLLEKETPIFKTIKY | ||||||
Chain | PRO_0000445865 | 129-466 | Movement protein | |||
Sequence: MNEANITPVHTIPKDTLLKRASDYKLAVESKKSILPRVQDLYEMDKWHNLRSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPVVEKYTEEVADDRLPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRASGVPSHVIYFPMHRVPACDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEKVTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNAQQTEAITTDRGILFPKPKFKGNEVVLNYTGSGKIRNVGSQRFETKKNATGEQFVRSVDDLGCLSDEDGKDYRYGQ | ||||||
Chain | PRO_0000445866 | 467-868 | Large capsid protein | |||
Sequence: GLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKFAPVVVIQTLSKWLNAPKVDARISFAIYYEPTVVLPKQIATLEHAPAFMFRKEVGTLAFKQGERVAYSFEVNLGKPQTDGKEVTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDISFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQ | ||||||
Chain | PRO_0000445867 | 869-1065 | Small capsid protein | |||
Sequence: AHATPKDFSSVRFVMGHWKYRAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLLQNCAWMRGTLRFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSFSREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDTVVLYGQFDSNVEFAGQRKGGHYLLEKETPIFKTIKY |
Post-translational modification
RNA2 polyprotein
Specific enzymatic cleavages by picornain 3C-like protease in vivo yield mature proteins.
Interaction
Subunit
Small capsid protein
Interacts with the large capsid protein (By similarity).
Interacts with the movement protein (via C-terminus) (PubMed:19463725).
Interacts with the movement protein (via C-terminus) (PubMed:19463725).
Large capsid protein
Interacts with the small capsid protein (By similarity).
Homomultimer; assembles as pentons (By similarity).
Homomultimer; assembles as pentons (By similarity).
Movement protein
Interacts (via C-terminus) with the small capsid protein (PubMed:19463725).
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative initiation.
Q9Q2Q3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameRNA2 polyprotein
- Synonyms119kDa protein
- Length1,065
- Mass (Da)119,214
- Last updated2000-05-01 v1
- ChecksumC3B9CDF05AF74A7D
Q9Q2Q3-2
- NameRNA2 polyprotein 104kDa
- Synonyms104kDa protein
- Differences from canonical
- 1-128: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_059983 | 1-128 | in isoform RNA2 polyprotein 104kDa | |||
Sequence: Missing |
Keywords
- Coding sequence diversity