Q9PWR3 · PITX2_XENLA
- ProteinPituitary homeobox 2
- Genepitx2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids326 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Involved in left-right asymmetry of the developing embryo (PubMed:10585561).
May play an important role in development and maintenance of anterior structures. Could play a role at the interface of lateral plate signaling and heart and gut morphogenesis
May play an important role in development and maintenance of anterior structures. Could play a role at the interface of lateral plate signaling and heart and gut morphogenesis
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 94-153 | Homeobox | ||||
Sequence: QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Biological Process | embryonic organ morphogenesis | |
Biological Process | heart morphogenesis |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended namePituitary homeobox 2
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ9PWR3
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000049228 | 1-326 | Pituitary homeobox 2 | |||
Sequence: MNSMKEPLHLDHLAGSRVAAASSHHHHHHHHQHQTVTLVSMASSLGQRSGECKSRLEVHTISDTSSPDTADKDKSHQTKNEDSSTDDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSSPNSISSMSMSSGMVPSAVTGVPGSGLNSLNNLNNLSNPSLNTAVPTSACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYATVQTPGSNLSACQYAVDRPV |
Expression
Induction
By nodal/nr-1 in the left lateral plate mesoderm.
Developmental stage
Asymmetrically expressed in the left lateral plate mesoderm, tubular heart and early gut tube.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 17-37 | Disordered | ||||
Sequence: RVAAASSHHHHHHHHQHQTVT | ||||||
Region | 58-106 | Disordered | ||||
Sequence: VHTISDTSSPDTADKDKSHQTKNEDSSTDDPSKKKRQRRQRTHFTSQQL | ||||||
Compositional bias | 66-92 | Basic and acidic residues | ||||
Sequence: SPDTADKDKSHQTKNEDSSTDDPSKKK | ||||||
Motif | 288-301 | OAR | ||||
Sequence: SSLASLRLKAKQHS | ||||||
Motif | 294-298 | Nuclear localization signal | ||||
Sequence: RLKAK |
Sequence similarities
Belongs to the paired homeobox family. Bicoid subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9PWR3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NamePTX2A
- Length326
- Mass (Da)36,339
- Last updated2000-05-01 v1
- Checksum74366F0E4FB48E73
Q9PWR3-2
- NamePTX2B
- Differences from canonical
- 1-70: MNSMKEPLHLDHLAGSRVAAASSHHHHHHHHQHQTVTLVSMASSLGQRSGECKSRLEVHTISDTSSPDTA → MDSNCRKLVTTCVQLGVQPSAVECLFSKESDMKKGGFSAADGTEGNRKETGKRFSRIHQSGS
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_002270 | 1-70 | in isoform PTX2B | |||
Sequence: MNSMKEPLHLDHLAGSRVAAASSHHHHHHHHQHQTVTLVSMASSLGQRSGECKSRLEVHTISDTSSPDTA → MDSNCRKLVTTCVQLGVQPSAVECLFSKESDMKKGGFSAADGTEGNRKETGKRFSRIHQSGS | ||||||
Compositional bias | 66-92 | Basic and acidic residues | ||||
Sequence: SPDTADKDKSHQTKNEDSSTDDPSKKK | ||||||
Sequence conflict | 78 | in Ref. 2; CAA06697 | ||||
Sequence: T → S | ||||||
Sequence conflict | 83 | in Ref. 2; CAA06697 | ||||
Sequence: S → N | ||||||
Sequence conflict | 158 | in Ref. 2; CAA06697 | ||||
Sequence: A → T | ||||||
Sequence conflict | 190 | in Ref. 2; CAA06697 | ||||
Sequence: A → T | ||||||
Sequence conflict | 306-307 | in Ref. 2; CAA06697 | ||||
Sequence: Missing | ||||||
Sequence conflict | 310 | in Ref. 2; CAA06697 | ||||
Sequence: T → N | ||||||
Sequence conflict | 323 | in Ref. 1; AAC29426 | ||||
Sequence: D → N |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF077767 EMBL· GenBank· DDBJ | AAC29426.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ005786 EMBL· GenBank· DDBJ | CAA06696.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ005787 EMBL· GenBank· DDBJ | CAA06697.1 EMBL· GenBank· DDBJ | mRNA |