Q9PTM7 · Q9PTM7_DANRE
- ProteinMeis homeobox 2b
- Genemeis2b
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids393 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 275-337 | Homeobox | ||||
Sequence: RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRRIVQPM |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Biological Process | cardiac atrium morphogenesis | |
Biological Process | heart development | |
Biological Process | heart looping | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ9PTM7
Proteomes
Organism-specific databases
Subcellular Location
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 202-282 | Disordered | ||||
Sequence: DDLSGSSTNLADHNPASWRDMDDAHSTPSVGTPGPSSGGHASQSGDNSSELGDGLDNSLASPGTGDEDDQDKKRQKKRGIF | ||||||
Compositional bias | 230-256 | Polar residues | ||||
Sequence: SVGTPGPSSGGHASQSGDNSSELGDGL | ||||||
Domain | 273-336 | Homeobox | ||||
Sequence: KKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRRIVQP |
Sequence similarities
Belongs to the TALE/MEIS homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length393
- Mass (Da)43,044
- Last updated2000-05-01 v1
- ChecksumF8ABE38374874D32
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3AK57 | A0A8M3AK57_DANRE | meis2a | 409 | ||
A0A8M3AJB0 | A0A8M3AJB0_DANRE | meis2a | 402 | ||
Q9DDE0 | Q9DDE0_DANRE | meis2b | 393 | ||
A0A8M3AUL9 | A0A8M3AUL9_DANRE | meis2a | 408 | ||
A0A8M3AUM6 | A0A8M3AUM6_DANRE | meis2a | 389 | ||
A0A8M3ARP6 | A0A8M3ARP6_DANRE | meis2a | 408 | ||
A0A0H2UKR5 | A0A0H2UKR5_DANRE | meis2a | 390 | ||
A0A8M3B2P5 | A0A8M3B2P5_DANRE | meis2a | 396 | ||
Q6PHK8 | Q6PHK8_DANRE | meis2a | 397 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 230-256 | Polar residues | ||||
Sequence: SVGTPGPSSGGHASQSGDNSSELGDGL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF170065 EMBL· GenBank· DDBJ | AAF23096.1 EMBL· GenBank· DDBJ | mRNA |