Q9P4U8 · AKTR2_ALTAL
- ProteinTranscription activator AKTR-2
- GeneAKTR-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids435 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Transcription factor that regulates the expression of the gene clusters that mediate the biosynthesis of the host-selective toxins (HSTs) AK-toxins responsible for Japanese pear black spot disease by the Japanese pear pathotype (Probable). AK-toxins are esters of 9,10-epoxy 8-hydroxy 9-methyldecatrienoic acid (EDA) (PubMed:22846083).
On cellular level, AK-toxins affect plasma membrane of susceptible cells and cause a sudden increase in loss of K+ after a few minutes of toxin treatment (PubMed:22846083).
On cellular level, AK-toxins affect plasma membrane of susceptible cells and cause a sudden increase in loss of K+ after a few minutes of toxin treatment (PubMed:22846083).
Miscellaneous
Gene clusters encoding host-selective toxins (HSTs) are localized on conditionally dispensable chromosomes (CDCs), also called supernumerary chromosomes, where they are present in multiple copies (PubMed:10975654).
The CDCs are not essential for saprophytic growth but controls host-selective pathogenicity (PubMed:10975654).
The CDCs are not essential for saprophytic growth but controls host-selective pathogenicity (PubMed:10975654).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 16-43 | Zn2-C6 fungal-type | ||||
Sequence: CDFCTQSKLRCNKNKPSCRRCTIQQQVC |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | zinc ion binding |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTranscription activator AKTR-2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Dothideomycetes > Pleosporomycetidae > Pleosporales > Pleosporineae > Pleosporaceae > Alternaria > Alternaria sect. Alternaria > Alternaria alternata complex
Accessions
- Primary accessionQ9P4U8
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444842 | 1-435 | Transcription activator AKTR-2 | |||
Sequence: MLQCAPKKNERLRGSCDFCTQSKLRCNKNKPSCRRCTIQQQVCVYSVARRTGRPPKHPRRADDSQETSGQHGHQDPMTSAPADSCEQQSSHLDLEGDDTDFTLVDGRTTAEGRATVAPPVLDNAFLMGETFEFNSLLDDPLVQSEDIFSFSPHIPRGEKGVHMASFHALNESTSPCSPSALLSIDVPQLPTNFRFLESFIGSELHGRNEPHPVEQPDEMEKTYDKGSILLGLDSAINAITNNGKDEPSISGWTVARPHSKHLCFCSMSMSKLQVLVSHPALCRQNSRTPFDMVLFLEEFVFGIHSDVLRCLICQSRSLHSLASLCICTDWVVEALVDVAQDLSLGQDNLGGLRAEICPPKNGSSIYVGRLILADQFRESCTRSLVKYRLRKLIPIMDTMIKLNYRGAGGALSQAIRTMVEDVRHKIESALGMMEL |
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 49-103 | Disordered | ||||
Sequence: RRTGRPPKHPRRADDSQETSGQHGHQDPMTSAPADSCEQQSSHLDLEGDDTDFTL | ||||||
Compositional bias | 70-89 | Polar residues | ||||
Sequence: QHGHQDPMTSAPADSCEQQS |
Family and domain databases
Sequence
- Sequence statusComplete
- Length435
- Mass (Da)48,235
- Last updated2000-10-01 v1
- ChecksumAAD028C78F51A1C9
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 70-89 | Polar residues | ||||
Sequence: QHGHQDPMTSAPADSCEQQS |