Q9P0S2 · COX16_HUMAN
- ProteinCytochrome c oxidase assembly protein COX16 homolog, mitochondrial
- GeneCOX16
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids106 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136, PubMed:33169484).
Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136).
Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136).
Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).
Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136).
Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136).
Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).
Miscellaneous
No COX16 mutations have been detected in patients with cytochrome c oxidase (COX) deficiency.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Biological Process | mitochondrial cytochrome c oxidase assembly |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase assembly protein COX16 homolog, mitochondrial
- Short nameshCOX16
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9P0S2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-14 | Mitochondrial matrix | ||||
Sequence: MFAPAVMRAFRKNK | ||||||
Transmembrane | 15-37 | Helical | ||||
Sequence: TLGYGVPMLLLIVGGSFGLREFS | ||||||
Topological domain | 38-106 | Mitochondrial intermembrane | ||||
Sequence: QIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Mitochondrial complex IV deficiency, nuclear type 22 (MC4DN22)
- Note
- DescriptionAn autosomal recessive mitochondrial disorder characterized by hypertrophic cardiomyopathy, encephalopathy, fatal lactic acidosis, and isolated complex IV deficiency.
- See alsoMIM:619355
Natural variants in MC4DN22
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_085648 | 82-106 | missing | in MC4DN22; isolated complex IV deficiency in homozygous patient cells |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_085648 | 82-106 | in MC4DN22; isolated complex IV deficiency in homozygous patient cells | |||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 123 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000019556 | 1-106 | Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial | |||
Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed. Expressed at higher level in skeletal muscle, heart and liver.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Associates with the MITRAC complex (PubMed:29381136).
Interacts with MT-CO2/COX; specifically interacts with newly synthesized MT-CO2/COX (PubMed:29355485, PubMed:29381136).
Interacts with SCO1, SCO2 and COA6 (PubMed:29381136).
Interacts with MT-CO2/COX; specifically interacts with newly synthesized MT-CO2/COX (PubMed:29355485, PubMed:29381136).
Interacts with SCO1, SCO2 and COA6 (PubMed:29381136).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9P0S2 | FAM25C B3EWG5 | 3 | EBI-6570716, EBI-14240149 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 77-106 | Disordered | ||||
Sequence: DWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
Sequence similarities
Belongs to the COX16 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length106
- Mass (Da)12,293
- Last updated2000-10-01 v1
- ChecksumEB84EE268DF62B07
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WX56 | A0A087WX56_HUMAN | COX16 | 53 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FJ460510 EMBL· GenBank· DDBJ | ACJ76681.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ460511 EMBL· GenBank· DDBJ | ACJ76682.1 EMBL· GenBank· DDBJ | mRNA | ||
AF226729 EMBL· GenBank· DDBJ | AAG09730.1 EMBL· GenBank· DDBJ | mRNA | ||
AF151037 EMBL· GenBank· DDBJ | AAF36123.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290743 EMBL· GenBank· DDBJ | BAF83432.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457199 EMBL· GenBank· DDBJ | CAG33480.1 EMBL· GenBank· DDBJ | mRNA | ||
AL160191 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471061 EMBL· GenBank· DDBJ | EAW81031.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001702 EMBL· GenBank· DDBJ | AAH01702.1 EMBL· GenBank· DDBJ | mRNA |