Q9NZB2 · F120A_HUMAN
- ProteinConstitutive coactivator of PPAR-gamma-like protein 1
- GeneFAM120A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1118 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the oxidative stress-induced survival signaling. May regulate the activation of SRC family protein kinases (PubMed:19015244).
May act as a scaffolding protein enabling SRC family protein kinases to phosphorylate and activate PI3-kinase (PubMed:19015244).
Binds IGF2 RNA and promotes the production of IGF2 protein (PubMed:19015244).
May act as a scaffolding protein enabling SRC family protein kinases to phosphorylate and activate PI3-kinase (PubMed:19015244).
Binds IGF2 RNA and promotes the production of IGF2 protein (PubMed:19015244).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | RNA binding |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameConstitutive coactivator of PPAR-gamma-like protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NZB2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Note: Translocates from the cytosol to plasma membrane after UV irradiation.
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_054400 | 327 | in dbSNP:rs11541747 | |||
Sequence: Y → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 919 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000221627 | 1-1118 | UniProt | Constitutive coactivator of PPAR-gamma-like protein 1 | |||
Sequence: MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFHGLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSACRREAALEAAVLNKEE | |||||||
Modified residue (large scale data) | 383 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 395 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 413 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 417 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 418 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 428 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 431 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 444 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 487 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 501 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 506 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 507 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 508 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 510 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 511 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 513 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 638 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 652 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 655 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 655 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 873 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue | 884 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue | 886 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 925 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 932 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue | 960 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 982 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue | 986 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 990 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 991 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 1020 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 1023 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1023 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1044 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1044 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1045 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1045 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1048 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1048 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1067 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1075 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1077 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Arg-982 is dimethylated, probably to asymmetric dimethylarginine.
Phosphorylated on tyrosine by SRC family protein kinases upon oxidative stress, for instance following UV irradiation.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with PURA (By similarity).
Interacts with SRC family protein kinases YES1, SRC and FYN (PubMed:19015244).
Upon tyrosine phosphorylation, interacts with PIK3R1 (PubMed:19015244).
Interacts with IGF2BP1/IMP-1 in an RNA-dependent manner (PubMed:19015244).
Interacts with SRC family protein kinases YES1, SRC and FYN (PubMed:19015244).
Upon tyrosine phosphorylation, interacts with PIK3R1 (PubMed:19015244).
Interacts with IGF2BP1/IMP-1 in an RNA-dependent manner (PubMed:19015244).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NZB2 | UPF1 Q92900 | 3 | EBI-1171960, EBI-373471 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 339-405 | Interaction with YES1, SRC and FYN | ||||
Sequence: PPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTL | ||||||
Region | 374-533 | Disordered | ||||
Sequence: AKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLL | ||||||
Compositional bias | 401-423 | Polar residues | ||||
Sequence: APLTLDTSGKNLTEQNSYSNIPH | ||||||
Compositional bias | 434-485 | Polar residues | ||||
Sequence: SSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKT | ||||||
Compositional bias | 501-521 | Polar residues | ||||
Sequence: TKAEGSSTASSGSQLAEGKGS | ||||||
Region | 829-1118 | RNA binding | ||||
Sequence: ADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSACRREAALEAAVLNKEE | ||||||
Compositional bias | 921-940 | Polar residues | ||||
Sequence: AFSGSDSSRTSKSQGGVQPI | ||||||
Region | 921-945 | Disordered | ||||
Sequence: AFSGSDSSRTSKSQGGVQPIPSQGG | ||||||
Region | 1025-1102 | Disordered | ||||
Sequence: EEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSA | ||||||
Compositional bias | 1068-1098 | Polar residues | ||||
Sequence: TGDARAPSHSESALNNDSKTCNTNPHLNALS |
Sequence similarities
Belongs to the constitutive coactivator of PPAR-gamma family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
Q9NZB2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length1,118
- Mass (Da)121,888
- Last updated2007-09-11 v2
- ChecksumC9171EA01C8D17A0
Q9NZB2-2
- NameB
Q9NZB2-4
- NameD
- Differences from canonical
- 890-935: Missing
Q9NZB2-5
- NameE
Q9NZB2-6
- NameF
- Differences from canonical
- 473-473: N → KPFQLYLQKNFVFHKENSIVLCSRILRHG
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8V8TNY3 | A0A8V8TNY3_HUMAN | FAM120A | 1117 | ||
A0A494C0Y9 | A0A494C0Y9_HUMAN | FAM120A | 280 | ||
A0A0C4DG79 | A0A0C4DG79_HUMAN | FAM120A | 494 | ||
A0A0C4DH52 | A0A0C4DH52_HUMAN | FAM120A | 495 |
Sequence caution
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 401-423 | Polar residues | ||||
Sequence: APLTLDTSGKNLTEQNSYSNIPH | ||||||
Compositional bias | 434-485 | Polar residues | ||||
Sequence: SSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKT | ||||||
Alternative sequence | VSP_036324 | 473 | in isoform F | |||
Sequence: N → KPFQLYLQKNFVFHKENSIVLCSRILRHG | ||||||
Compositional bias | 501-521 | Polar residues | ||||
Sequence: TKAEGSSTASSGSQLAEGKGS | ||||||
Sequence conflict | 517-520 | in Ref. 1; AAF72867 | ||||
Sequence: EGKG → DSRR | ||||||
Sequence conflict | 556 | in Ref. 1; AAF72867 | ||||
Sequence: L → V | ||||||
Alternative sequence | VSP_004147 | 579-628 | in isoform B | |||
Sequence: GEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAF → VLSKGPWSGFCYLMSGHSYGCFVLLSFFEPFFCLTNLLETKFTFPFLNIE | ||||||
Alternative sequence | VSP_004148 | 629-1118 | in isoform B | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_017278 | 637-651 | in isoform E | |||
Sequence: FSPVIIKEWAAYKGK → CMYCNNPLFVFLGTS | ||||||
Alternative sequence | VSP_017279 | 652-1118 | in isoform E | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_017280 | 890-935 | in isoform D | |||
Sequence: Missing | ||||||
Compositional bias | 921-940 | Polar residues | ||||
Sequence: AFSGSDSSRTSKSQGGVQPI | ||||||
Compositional bias | 1068-1098 | Polar residues | ||||
Sequence: TGDARAPSHSESALNNDSKTCNTNPHLNALS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF214737 EMBL· GenBank· DDBJ | AAF72866.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF214738 EMBL· GenBank· DDBJ | AAF72867.1 EMBL· GenBank· DDBJ | mRNA | ||
AL353629 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC007879 EMBL· GenBank· DDBJ | AAH07879.2 EMBL· GenBank· DDBJ | mRNA | ||
BC098584 EMBL· GenBank· DDBJ | AAH98584.1 EMBL· GenBank· DDBJ | mRNA | ||
BC111736 EMBL· GenBank· DDBJ | AAI11737.1 EMBL· GenBank· DDBJ | mRNA | ||
D80005 EMBL· GenBank· DDBJ | BAA11500.2 EMBL· GenBank· DDBJ | mRNA | ||
AY266457 EMBL· GenBank· DDBJ | AAP31031.1 EMBL· GenBank· DDBJ | mRNA | ||
AF055017 EMBL· GenBank· DDBJ | AAC09364.1 EMBL· GenBank· DDBJ | mRNA |