Q9NZ43 · USE1_HUMAN
- ProteinVesicle transport protein USE1
- GeneUSE1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids259 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPI-coated vesicle | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | SNARE complex | |
Molecular Function | SNAP receptor activity | |
Biological Process | lysosomal transport | |
Biological Process | protein catabolic process | |
Biological Process | protein transport | |
Biological Process | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum | |
Biological Process | secretion by cell |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVesicle transport protein USE1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NZ43
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass type IV membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-231 | Cytoplasmic | ||||
Sequence: MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVN | ||||||
Transmembrane | 232-252 | Helical; Anchor for type IV membrane protein | ||||
Sequence: WLLWAMLIIVCFIFISMILFI | ||||||
Topological domain | 253-259 | Lumenal | ||||
Sequence: RIMPKLK |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_021052 | 154 | in dbSNP:rs414528 | |||
Sequence: L → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 318 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000215579 | 1-259 | UniProt | Vesicle transport protein USE1 | |||
Sequence: MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK | |||||||
Modified residue (large scale data) | 146 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 204 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B. Interacts directly with STX18.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NZ43 | APOL2 Q9BQE5 | 3 | EBI-742842, EBI-4290634 | |
BINARY | Q9NZ43 | AQP6 Q13520 | 3 | EBI-742842, EBI-13059134 | |
BINARY | Q9NZ43 | BSCL2 J3KQ12 | 3 | EBI-742842, EBI-11532900 | |
BINARY | Q9NZ43 | CALN1 Q9BXU9 | 3 | EBI-742842, EBI-12187137 | |
BINARY | Q9NZ43 | CCDC70 Q6NSX1 | 3 | EBI-742842, EBI-6873045 | |
BINARY | Q9NZ43 | CCM2L Q9NUG4 | 3 | EBI-742842, EBI-350645 | |
BINARY | Q9NZ43 | EBP Q15125 | 3 | EBI-742842, EBI-3915253 | |
BINARY | Q9NZ43 | JAGN1 Q8N5M9 | 3 | EBI-742842, EBI-10266796 | |
BINARY | Q9NZ43 | MEOX2 P50222 | 3 | EBI-742842, EBI-748397 | |
BINARY | Q9NZ43 | MFSD14B Q5SR56 | 3 | EBI-742842, EBI-373355 | |
BINARY | Q9NZ43 | SCN3B Q9NY72 | 3 | EBI-742842, EBI-17247926 | |
BINARY | Q9NZ43 | STX18 Q9P2W9 | 11 | EBI-742842, EBI-725334 | |
BINARY | Q9NZ43 | STX1A Q16623 | 3 | EBI-742842, EBI-712466 | |
BINARY | Q9NZ43 | STX4 Q12846 | 3 | EBI-742842, EBI-744942 | |
BINARY | Q9NZ43 | TMEM86B Q8N661 | 3 | EBI-742842, EBI-2548832 | |
BINARY | Q9NZ43 | TRIM27 P14373 | 3 | EBI-742842, EBI-719493 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 152-231 | |||||
Sequence: KQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVN |
Sequence similarities
Belongs to the USE1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9NZ43-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length259
- Mass (Da)29,371
- Last updated2010-05-18 v2
- Checksum6538ED0B231AEC05
Q9NZ43-2
- Name2
Q9NZ43-3
- Name3
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 38 | in Ref. 4; AAH06005 | ||||
Sequence: A → V | ||||||
Alternative sequence | VSP_012662 | 132-135 | in isoform 3 | |||
Sequence: EPEM → GESP | ||||||
Alternative sequence | VSP_012663 | 136-259 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_012664 | 142-146 | in isoform 2 | |||
Sequence: GVAGS → PCHTH | ||||||
Alternative sequence | VSP_012665 | 147-259 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB097050 EMBL· GenBank· DDBJ | BAC77403.1 EMBL· GenBank· DDBJ | mRNA | ||
AK074683 EMBL· GenBank· DDBJ | BAC11136.1 EMBL· GenBank· DDBJ | mRNA | ||
AF220052 EMBL· GenBank· DDBJ | AAF67645.1 EMBL· GenBank· DDBJ | mRNA | ||
AC020913 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC006005 EMBL· GenBank· DDBJ | AAH06005.1 EMBL· GenBank· DDBJ | mRNA | ||
BC008455 EMBL· GenBank· DDBJ | AAH08455.1 EMBL· GenBank· DDBJ | mRNA |