Q9NYJ8 · TAB2_HUMAN
- ProteinTGF-beta-activated kinase 1 and MAP3K7-binding protein 2
- GeneTAB2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids693 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as an adapter linking MAP3K7/TAK1 and TRAF6 to 'Lys-63'-linked polyubiquitin chains (PubMed:10882101, PubMed:11460167, PubMed:15327770, PubMed:22158122).
The RanBP2-type zinc finger (NZF) specifically recognizes Lys-63'-linked polyubiquitin chains unanchored or anchored to the substrate proteins such as RIPK1/RIP1 and RIPK2: this acts as a scaffold to organize a large signaling complex to promote autophosphorylation of MAP3K7/TAK1, and subsequent activation of I-kappa-B-kinase (IKK) core complex by MAP3K7/TAK1 (PubMed:15327770, PubMed:18079694, PubMed:22158122).
Regulates the IL1-mediated translocation of NCOR1 out of the nucleus (By similarity).
Involved in heart development (PubMed:20493459).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endosome membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | K63-linked polyubiquitin modification-dependent protein binding | |
Molecular Function | molecular adaptor activity | |
Molecular Function | ubiquitin binding | |
Molecular Function | zinc ion binding | |
Biological Process | defense response to bacterium | |
Biological Process | heart development | |
Biological Process | inflammatory response | |
Biological Process | negative regulation of autophagy | |
Biological Process | non-canonical NF-kappaB signal transduction | |
Biological Process | positive regulation of canonical NF-kappaB signal transduction | |
Biological Process | positive regulation of protein kinase activity | |
Biological Process | response to lipopolysaccharide |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTGF-beta-activated kinase 1 and MAP3K7-binding protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NYJ8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Congenital heart defects, multiple types, 2 (CHTD2)
- Note
- DescriptionA disease characterized by congenital developmental abnormalities involving structures of the heart. CHTD2 patients have left ventricular outflow tract obstruction, subaortic stenosis, residual aortic regurgitation, atrial fibrillation, bicuspid aortic valve and aortic dilation.
- See alsoMIM:614980
Natural variants in CHTD2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_063774 | 208 | P>S | in CHTD2; dbSNP:rs267607101 | |
VAR_063775 | 230 | Q>K | in CHTD2; dbSNP:rs267607100 |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_063774 | 208 | in CHTD2; dbSNP:rs267607101 | |||
Sequence: P → S | ||||||
Natural variant | VAR_063775 | 230 | in CHTD2; dbSNP:rs267607100 | |||
Sequence: Q → K | ||||||
Mutagenesis | 329 | Loss of TRIM60-mediated SUMOylation; when associated with R-562. | ||||
Sequence: K → R | ||||||
Mutagenesis | 562 | Loss of TRIM60-mediated SUMOylation; when associated with R-329. | ||||
Sequence: K → R | ||||||
Natural variant | VAR_077348 | 569 | found in an patient with a form of frontometaphyseal dysplasia; uncertain significance; dbSNP:rs886039238 | |||
Sequence: E → K | ||||||
Mutagenesis | 611 | Loss of TRIM35-mediated ubiquitination. | ||||
Sequence: K → R | ||||||
Mutagenesis | 670 | Disrupted zinc-finger; abolished methylation at C-673. | ||||
Sequence: C → S | ||||||
Mutagenesis | 673 | Abolished Cys methylation and ability to bind 'Lys-63'-linked ubiquitin. | ||||
Sequence: C → L or M | ||||||
Mutagenesis | 675 | Abolishes ubiquitin binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 678 | Abolishes ubiquitin binding. | ||||
Sequence: H → A | ||||||
Mutagenesis | 681 | Abolishes ubiquitin binding. | ||||
Sequence: L → A | ||||||
Mutagenesis | 684 | Disrupted zinc-finger; abolished methylation at C-673. | ||||
Sequence: C → S | ||||||
Mutagenesis | 685 | Abolishes ubiquitin binding. | ||||
Sequence: E → A | ||||||
Mutagenesis | 687 | Disrupted zinc-finger; abolished methylation at C-673. | ||||
Sequence: C → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 751 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, cross-link, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000225695 | 1-693 | UniProt | TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 | |||
Sequence: MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF | |||||||
Modified residue | 173 | UniProt | Asymmetric dimethylarginine | ||||
Sequence: R | |||||||
Cross-link | 329 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 350 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 372 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 372 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 449 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 450 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 450 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 482 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 524 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 524 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 527 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 562 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | |||||||
Modified residue | 582 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 582 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 584 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 611 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | |||||||
Modified residue | 673 | UniProt | (Microbial infection) S-methylcysteine | ||||
Sequence: C |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Identified in the TRIKA2 complex composed of MAP3K7, TAB1 and TAB2 (PubMed:11460167).
Binds 'Lys-63'-linked polyubiquitin chains (PubMed:19675569, PubMed:19935683).
Interacts with NCOR1 and HDAC3 to form a ternary complex (By similarity).
Interacts (via C-terminal) with NUMBL (via PTB domain) (PubMed:18299187).
Interacts (via the C-terminus) with DYNC2I2 (via WD domains) (PubMed:19521662).
Interacts with RBCK1 (PubMed:17449468).
Interacts with TRIM5 (PubMed:21512573).
Interacts with TRIM38 (via B30.2/SPRY domain), leading to its translocation to lysosomes and degradation (PubMed:24434549).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-51 | CUE | ||||
Sequence: IDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQEST | ||||||
Region | 91-130 | Disordered | ||||
Sequence: GREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAP | ||||||
Region | 219-310 | Disordered | ||||
Sequence: ITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSSGSSQSSAHS | ||||||
Region | 330-381 | Disordered | ||||
Sequence: LEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVYIAASPPNTDELMS | ||||||
Coiled coil | 532-619 | |||||
Sequence: YTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQAR | ||||||
Region | 642-663 | Disordered | ||||
Sequence: PPKPKDQRSIIKTPKTQDTEDD | ||||||
Compositional bias | 649-663 | Basic and acidic residues | ||||
Sequence: RSIIKTPKTQDTEDD | ||||||
Zinc finger | 663-693 | RanBP2-type | ||||
Sequence: DEGAQWNCTACTFLNHPALIRCEQCEMPRHF | ||||||
Region | 675-685 | Interaction with polyubiquitin | ||||
Sequence: FLNHPALIRCE |
Domain
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9NYJ8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length693
- Mass (Da)76,494
- Last updated2000-10-01 v1
- Checksum47BB8709320084D7
Q9NYJ8-2
- Name2
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1B0GV57 | A0A1B0GV57_HUMAN | TAB2 | 409 | ||
A0A8V8TQR7 | A0A8V8TQR7_HUMAN | TAB2 | 553 | ||
U3KQ62 | U3KQ62_HUMAN | TAB2 | 33 | ||
U3KQR0 | U3KQR0_HUMAN | TAB2 | 130 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF241230 EMBL· GenBank· DDBJ | AAF67176.1 EMBL· GenBank· DDBJ | mRNA | ||
AB018276 EMBL· GenBank· DDBJ | BAA34453.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK315038 EMBL· GenBank· DDBJ | BAG37521.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457387 EMBL· GenBank· DDBJ | CAG33668.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ314877 EMBL· GenBank· DDBJ | ABC40736.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL117407 EMBL· GenBank· DDBJ | CAB55907.1 EMBL· GenBank· DDBJ | mRNA | ||
AL031133 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL139103 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL138727 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471051 EMBL· GenBank· DDBJ | EAW47805.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471051 EMBL· GenBank· DDBJ | EAW47806.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471051 EMBL· GenBank· DDBJ | EAW47807.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC035910 EMBL· GenBank· DDBJ | AAH35910.1 EMBL· GenBank· DDBJ | mRNA |