Q9NXK8 · FXL12_HUMAN
- ProteinF-box/LRR-repeat protein 12
- GeneFBXL12
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids326 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the polyubiquitination and proteasomal degradation of CAMK1 leading to disruption of cyclin D1/CDK4 complex assembly which results in G1 cell cycle arrest in lung epithelia.
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | SCF ubiquitin ligase complex | |
Biological Process | protein ubiquitination | |
Biological Process | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameF-box/LRR-repeat protein 12
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NXK8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_064712 | 63 | found in a renal cell carcinoma case; somatic mutation | |||
Sequence: L → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 365 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000119857 | 1-326 | F-box/LRR-repeat protein 12 | |||
Sequence: MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with SKP1 and CUL1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NXK8 | CDKN1C P49918 | 6 | EBI-719790, EBI-519256 | |
BINARY | Q9NXK8 | DOCK8 Q8NF50-2 | 3 | EBI-719790, EBI-10174653 | |
BINARY | Q9NXK8 | GEMIN4 P57678 | 3 | EBI-719790, EBI-356700 | |
BINARY | Q9NXK8 | LNX1 Q8TBB1 | 3 | EBI-719790, EBI-739832 | |
BINARY | Q9NXK8 | RNF32 Q9H0A6 | 2 | EBI-719790, EBI-724829 | |
BINARY | Q9NXK8 | SKP1 P63208 | 10 | EBI-719790, EBI-307486 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-47 | F-box | ||||
Sequence: MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHV | ||||||
Repeat | 51-78 | LRR 1 | ||||
Sequence: LYTMRPKVMWHLLRRYMASRLHSLRMGG | ||||||
Repeat | 86-111 | LRR 2 | ||||
Sequence: APQLSPALLRALGQKCPNLKRLCLHV | ||||||
Repeat | 113-133 | LRR 3 | ||||
Sequence: DLSMVPITSLPSTLRTLELHS | ||||||
Repeat | 161-185 | LRR 4 | ||||
Sequence: VPAFRDEHLQGLTRFRALRSLVLGG | ||||||
Repeat | 186-211 | LRR 5 | ||||
Sequence: TYRVTETGLDAGLQELSYLQRLEVLG | ||||||
Repeat | 212-236 | LRR 6 | ||||
Sequence: CTLSADSTLLAISRHLRDVRKIRLT | ||||||
Repeat | 237-261 | LRR 7 | ||||
Sequence: VRGLSAPGLAVLEGMPALESLCLQG | ||||||
Repeat | 266-291 | LRR 8 | ||||
Sequence: PEMPSPTEILSSCLTMPKLRVLELQG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9NXK8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length326
- Mass (Da)37,026
- Last updated2000-10-01 v1
- Checksum1BC5C2A40CB91D68
Q9NXK8-2
- Name2
- Differences from canonical
- 1-53: Missing
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_008859 | 1-53 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK000195 EMBL· GenBank· DDBJ | BAA91002.1 EMBL· GenBank· DDBJ | mRNA | ||
AK027004 EMBL· GenBank· DDBJ | BAB15622.1 EMBL· GenBank· DDBJ | mRNA | ||
AK093760 EMBL· GenBank· DDBJ | BAG52760.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471106 EMBL· GenBank· DDBJ | EAW84051.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001586 EMBL· GenBank· DDBJ | AAH01586.1 EMBL· GenBank· DDBJ | mRNA |