Q9NUU6 · OTULL_HUMAN
- ProteinInactive ubiquitin thioesterase OTULINL
- GeneOTULINL
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids356 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Lacks deubiquitinase activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic side of endoplasmic reticulum membrane | |
Cellular Component | nuclear envelope |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInactive ubiquitin thioesterase OTULINL
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NUU6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Peripheral membrane protein
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2-83 | Loss of membrane binding. | ||||
Sequence: Missing | ||||||
Mutagenesis | 139 | Fails to confer catalytic activity; when associated with N-352. | ||||
Sequence: D → C | ||||||
Natural variant | VAR_030281 | 319 | in dbSNP:rs16903574 | |||
Sequence: F → L | ||||||
Mutagenesis | 352 | Fails to confer catalytic activity; when associated with C-139. | ||||
Sequence: H → N |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 424 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000274404 | 1-356 | Inactive ubiquitin thioesterase OTULINL | |||
Sequence: MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAICYFRRLHLYSGHKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKEKDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLYEALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF |
Proteomic databases
PTM databases
Interaction
Subunit
Does not bind ubiquitin or ubiquitin-like proteins.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NUU6 | AQP6 Q13520 | 3 | EBI-6916492, EBI-13059134 | |
BINARY | Q9NUU6 | GOLT1A Q6ZVE7 | 3 | EBI-6916492, EBI-17231387 | |
BINARY | Q9NUU6 | HSD17B11 Q8NBQ5 | 3 | EBI-6916492, EBI-1052304 | |
BINARY | Q9NUU6 | HTRA2 O43464 | 3 | EBI-6916492, EBI-517086 | |
BINARY | Q9NUU6 | JAGN1 Q8N5M9 | 3 | EBI-6916492, EBI-10266796 | |
BINARY | Q9NUU6 | KLF11 O14901 | 3 | EBI-6916492, EBI-948266 | |
BINARY | Q9NUU6 | RETREG3 Q86VR2 | 3 | EBI-6916492, EBI-10192441 | |
BINARY | Q9NUU6 | SLC30A8 Q8IWU4 | 3 | EBI-6916492, EBI-10262251 | |
BINARY | Q9NUU6 | TMEM14B Q9NUH8 | 3 | EBI-6916492, EBI-8638294 | |
BINARY | Q9NUU6 | TMEM86B Q8N661 | 3 | EBI-6916492, EBI-2548832 | |
BINARY | Q9NUU6 | TMX2 Q9Y320 | 3 | EBI-6916492, EBI-6447886 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MAATRSPTRARERERSGAPAAG | ||||||
Region | 1-83 | Required for membrane binding | ||||
Sequence: MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAICYFRRLHLYSGHKLKWWIGYLQRK | ||||||
Domain | 128-356 | OTU | ||||
Sequence: KCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKEKDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLYEALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQIDMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF |
Domain
The N-terminal region that precedes the OTU domain mediates interaction with cellular membranes.
Sequence similarities
Belongs to the peptidase C65 family. Otulin subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length356
- Mass (Da)42,196
- Last updated2000-10-01 v1
- Checksum91EEC6C877D5315B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 322 | in Ref. 2; BAD96451 | ||||
Sequence: N → I |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK001989 EMBL· GenBank· DDBJ | BAA92023.1 EMBL· GenBank· DDBJ | mRNA | ||
AK222731 EMBL· GenBank· DDBJ | BAD96451.1 EMBL· GenBank· DDBJ | mRNA | ||
BC011524 EMBL· GenBank· DDBJ | AAH11524.1 EMBL· GenBank· DDBJ | mRNA | ||
AL512750 EMBL· GenBank· DDBJ | CAC21673.1 EMBL· GenBank· DDBJ | mRNA |