Q9NU02 · ANKE1_HUMAN
- ProteinAnkyrin repeat and EF-hand domain-containing protein 1
- GeneANKEF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids776 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | calcium ion binding |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAnkyrin repeat and EF-hand domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NU02
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_033500 | 74 | in dbSNP:rs7260784 | |||
Sequence: P → T | ||||||
Natural variant | VAR_024172 | 324 | in dbSNP:rs652633 | |||
Sequence: L → Q | ||||||
Natural variant | VAR_033501 | 412 | in dbSNP:rs524625 | |||
Sequence: G → E | ||||||
Natural variant | VAR_035609 | 694 | in a breast cancer sample; somatic mutation | |||
Sequence: K → N | ||||||
Natural variant | VAR_033502 | 742 | in dbSNP:rs6087119 | |||
Sequence: R → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,007 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000066899 | 1-776 | Ankyrin repeat and EF-hand domain-containing protein 1 | |||
Sequence: MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSNDIDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAINSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAASKEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRGDGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGMGKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDVVKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLKGKTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKVDITFIPRRIWSPEATTAELIRKRELRRERFTHEVDFDDFMMPFQKNITEKARALEAALKT |
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NU02 | CASP6 P55212 | 3 | EBI-8464238, EBI-718729 | |
BINARY | Q9NU02 | CCK P06307 | 3 | EBI-8464238, EBI-6624398 | |
BINARY | Q9NU02 | CLASRP Q8N2M8 | 3 | EBI-8464238, EBI-751069 | |
BINARY | Q9NU02 | COQ8A Q8NI60 | 3 | EBI-8464238, EBI-745535 | |
BINARY | Q9NU02 | LAMP2 P13473-2 | 3 | EBI-8464238, EBI-21591415 | |
BINARY | Q9NU02 | P4HB P07237 | 3 | EBI-8464238, EBI-395883 | |
BINARY | Q9NU02 | PRPF40A O75400-2 | 3 | EBI-8464238, EBI-5280197 | |
BINARY | Q9NU02 | SH3GLB1 Q9Y371 | 3 | EBI-8464238, EBI-2623095 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 47-76 | ANK 1 | ||||
Sequence: NGLSALHLASVSNDIDMVSFLLDLGAHPDV | ||||||
Repeat | 184-213 | ANK 2 | ||||
Sequence: TGRTALMEASREGVVEIVRGILERGGEVNA | ||||||
Repeat | 217-246 | ANK 3 | ||||
Sequence: DRHHAAHFAAKGGFFDILKLLFAYNGDVGL | ||||||
Repeat | 250-279 | ANK 4 | ||||
Sequence: NGNTPLHYAAMGGFADCCKYIAQRGCDLKW | ||||||
Domain | 335-369 | EF-hand | ||||
Sequence: EREAFLREAFAVLDRGDGSISKNDFVMVLEERQDY | ||||||
Repeat | 524-553 | ANK 5 | ||||
Sequence: YYKTPLMTACASGNIDVVKFLLEKGANVNA | ||||||
Repeat | 557-586 | ANK 6 | ||||
Sequence: FLWTPLHFACHAGQQDIVELLVESGALIDA | ||||||
Repeat | 590-619 | ANK 7 | ||||
Sequence: NNSTPLNRAIESCRLDTVKYLLDIGAKFQL | ||||||
Repeat | 623-652 | ANK 8 | ||||
Sequence: KGHSAMDVAKAYADYRIIDLIKEKLDNLPK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length776
- Mass (Da)86,664
- Last updated2001-06-01 v2
- Checksum2F71F35AC4D337B6
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK025322 EMBL· GenBank· DDBJ | BAB15111.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK097689 EMBL· GenBank· DDBJ | BAG53512.1 EMBL· GenBank· DDBJ | mRNA | ||
AL109754 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471133 EMBL· GenBank· DDBJ | EAX10355.1 EMBL· GenBank· DDBJ | Genomic DNA |