Q9NS37 · ZHANG_HUMAN
- ProteinCREB/ATF bZIP transcription factor
- GeneCREBZF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids354 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Miscellaneous
Named 'Zhangfei' after a legendary Chinese warrior who was contemporary with Luman in around 220 AD.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | mitochondrion | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase II transcription regulator complex | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | identical protein binding | |
Biological Process | ATF6-mediated unfolded protein response | |
Biological Process | integrated stress response signaling | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of gene expression, epigenetic | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-binding transcription factor activity | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | response to virus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCREB/ATF bZIP transcription factor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NS37
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes in promyelocytic leukemia protein nuclear bodies (PML-NB) with CREB3 and HCFC1.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 303 | Significantly reduced binding to HCFC1. | ||||
Sequence: D → A | ||||||
Mutagenesis | 304 | Significantly reduced binding to HCFC1. | ||||
Sequence: H → A | ||||||
Mutagenesis | 306 | Does not interact with HCFC1 and is inefficient at inhibiting CREB3 transcriptional activity. Does not colocalize with CREB3 in promyelocytic leukemia protein nuclear bodies (PML-NB). | ||||
Sequence: Y → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 452 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000076645 | 1-354 | UniProt | CREB/ATF bZIP transcription factor | |||
Sequence: MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM | |||||||
Modified residue (large scale data) | 12 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 14 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 16 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 18 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 20 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 22 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 45 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 50 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 50 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 189 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 209 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with HCFC1; the interaction inhibits CREB3 transcriptional activity (PubMed:10871379, PubMed:15705566).
Interacts with CREB3; the interaction occurs only in combination with HCFC1 (PubMed:15705566).
Interacts with CREB3; the interaction occurs only in combination with HCFC1 (PubMed:15705566).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NS37 | ACYP2 P14621 | 3 | EBI-632965, EBI-10198377 | |
BINARY | Q9NS37 | ATF4 P18848 | 7 | EBI-632965, EBI-492498 | |
BINARY | Q9NS37 | CREB3 O43889 | 3 | EBI-632965, EBI-625002 | |
BINARY | Q9NS37 | CREBZF Q9NS37 | 5 | EBI-632965, EBI-632965 | |
BINARY | Q9NS37 | CTNNBL1 Q8WYA6 | 3 | EBI-632965, EBI-748128 | |
XENO | Q9NS37 | Esrrg P62509 | 3 | EBI-632965, EBI-5274019 | |
XENO | Q9NS37 | HBZ P0C746 | 3 | EBI-632965, EBI-10890294 | |
BINARY | Q9NS37 | HCFC1 P51610 | 8 | EBI-632965, EBI-396176 | |
BINARY | Q9NS37 | HCFC1 P51610-4 | 3 | EBI-632965, EBI-18150048 | |
BINARY | Q9NS37 | NFE2L1 Q14494 | 3 | EBI-632965, EBI-2804436 | |
BINARY | Q9NS37 | NFE2L2 Q16236 | 5 | EBI-632965, EBI-2007911 | |
BINARY | Q9NS37 | RALBP1 Q15311 | 5 | EBI-632965, EBI-749285 | |
BINARY | Q9NS37 | SIRT1 Q96EB6 | 3 | EBI-632965, EBI-1802965 | |
BINARY | Q9NS37 | TAF4 O00268 | 2 | EBI-632965, EBI-1034261 | |
BINARY | Q9NS37 | TTC23 Q5W5X9 | 3 | EBI-632965, EBI-6447954 | |
BINARY | Q9NS37 | TTC23 Q5W5X9-3 | 3 | EBI-632965, EBI-9090990 | |
BINARY | Q9NS37 | XBP1 P17861 | 4 | EBI-632965, EBI-6942961 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-95 | Disordered | ||||
Sequence: MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEE | ||||||
Compositional bias | 8-29 | Polar residues | ||||
Sequence: LLAASGSNSPTRSESPEPAATC | ||||||
Region | 113-156 | Disordered | ||||
Sequence: PRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEM | ||||||
Region | 171-214 | Disordered | ||||
Sequence: GGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAA | ||||||
Domain | 204-267 | bZIP | ||||
Sequence: QAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYL | ||||||
Region | 219-226 | Basic motif | ||||
Sequence: RLNRLKKK | ||||||
Region | 232-267 | Leucine-zipper | ||||
Sequence: LESRVRGLAAENQELRAENRELGKRVQALQEESRYL | ||||||
Motif | 303-306 | HCFC1-binding motif (HBM) | ||||
Sequence: DHDY |
Sequence similarities
Belongs to the bZIP family. ATF subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length354
- Mass (Da)37,134
- Last updated2009-07-07 v2
- ChecksumBE3AC77203216155
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 8-29 | Polar residues | ||||
Sequence: LLAASGSNSPTRSESPEPAATC | ||||||
Sequence conflict | 16 | in Ref. 3; AAH60807 | ||||
Sequence: S → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF039942 EMBL· GenBank· DDBJ | AAD28325.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AP000642 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC060807 EMBL· GenBank· DDBJ | AAH60807.1 EMBL· GenBank· DDBJ | mRNA | ||
BC093796 EMBL· GenBank· DDBJ | AAH93796.2 EMBL· GenBank· DDBJ | mRNA | ||
BC093798 EMBL· GenBank· DDBJ | AAH93798.2 EMBL· GenBank· DDBJ | mRNA | ||
AK313471 EMBL· GenBank· DDBJ | BAG36256.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
DQ128105 EMBL· GenBank· DDBJ | AAZ42189.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |