Q9NRP2 · COXM2_HUMAN
- ProteinCOX assembly mitochondrial protein 2 homolog
- GeneCMC2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
May be involved in cytochrome c oxidase biogenesis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCOX assembly mitochondrial protein 2 homolog
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NRP2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_033816 | 11 | in dbSNP:rs2303217 | |||
Sequence: T → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 120 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000192943 | 1-79 | COX assembly mitochondrial protein 2 homolog | |||
Sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK | ||||||
Disulfide bond | 14↔47 | |||||
Sequence: CNVLINLLKECHKNHNILKFFGYCNDVDRELRKC | ||||||
Disulfide bond | 24↔37 | |||||
Sequence: CHKNHNILKFFGYC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9NRP2 | C1orf216 Q8TAB5 | 3 | EBI-16780661, EBI-747505 | |
BINARY | Q9NRP2 | CTNNA3 Q9UI47-2 | 3 | EBI-16780661, EBI-11962928 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-55 | CHCH | ||||
Sequence: TEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVEN | ||||||
Motif | 14-24 | Cx9C motif 1 | ||||
Sequence: CNVLINLLKEC | ||||||
Motif | 37-47 | Cx9C motif 2 | ||||
Sequence: CNDVDRELRKC |
Sequence similarities
Belongs to the CMC family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length79
- Mass (Da)9,460
- Last updated2000-10-01 v1
- Checksum783381BD6DAFB7AA
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF201935 EMBL· GenBank· DDBJ | AAF86871.1 EMBL· GenBank· DDBJ | mRNA | ||
AC009079 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC092718 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471114 EMBL· GenBank· DDBJ | EAW95557.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471114 EMBL· GenBank· DDBJ | EAW95559.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471114 EMBL· GenBank· DDBJ | EAW95560.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC032631 EMBL· GenBank· DDBJ | AAH32631.1 EMBL· GenBank· DDBJ | mRNA |