Q9NQ94 · A1CF_HUMAN
- ProteinAPOBEC1 complementation factor
- GeneA1CF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids594 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apolipoprotein B mRNA editing enzyme complex | |
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | mRNA editing complex | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | enzyme-substrate adaptor activity | |
Molecular Function | mRNA binding | |
Molecular Function | RNA binding | |
Molecular Function | single-stranded RNA binding | |
Biological Process | cytidine to uridine editing | |
Biological Process | embryo implantation | |
Biological Process | mRNA localization resulting in post-transcriptional regulation of gene expression | |
Biological Process | mRNA modification | |
Biological Process | mRNA processing | |
Biological Process | negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | protein stabilization |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAPOBEC1 complementation factor
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NQ94
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly nuclear where it localizes to heterochromatin. Also cytoplasmic where it is found at the outer surface of the endoplasmic reticulum (By similarity).
Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1
Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 59 | Greatly reduced RNA binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 100 | Greatly reduced RNA binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 139 | Greatly reduced RNA binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 183 | Greatly reduced RNA binding. | ||||
Sequence: F → A | ||||||
Mutagenesis | 234 | Slightly reduced RNA binding. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 270 | Slightly reduced RNA binding. | ||||
Sequence: F → A | ||||||
Natural variant | VAR_052201 | 555 | in dbSNP:rs9073 | |||
Sequence: V → M | ||||||
Natural variant | VAR_059821 | 558 | in dbSNP:rs11817448 | |||
Sequence: A → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 857 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000081482 | 1-594 | APOBEC1 complementation factor | |||
Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF | ||||||
Modified residue | 499 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Part of the apolipoprotein B mRNA editing complex with APOBEC1 (PubMed:10669759, PubMed:10781591).
Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus (PubMed:12896982).
Interacts with SYNCRIP (PubMed:11134005).
Interacts with CELF2/CUGBP2 (PubMed:11577082).
Interacts with RBM47 (PubMed:24916387).
Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus (PubMed:12896982).
Interacts with SYNCRIP (PubMed:11134005).
Interacts with CELF2/CUGBP2 (PubMed:11577082).
Interacts with RBM47 (PubMed:24916387).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 56-134 | RRM 1 | ||||
Sequence: CEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVD | ||||||
Domain | 136-218 | RRM 2 | ||||
Sequence: CRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEP | ||||||
Domain | 231-303 | RRM 3 | ||||
Sequence: KILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKP | ||||||
Region | 360-409 | Required for nuclear localization | ||||
Sequence: HFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGR |
Domain
The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 6 isoforms produced by Alternative splicing.
Q9NQ94-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length594
- Mass (Da)65,202
- Last updated2000-10-01 v1
- ChecksumAA5EF76BD8815807
Q9NQ94-2
- Name2
- NoteMajor isoform found in 66-78% of cDNA clones.
- Differences from canonical
- 381-388: Missing
Q9NQ94-3
- Name3
Q9NQ94-4
- Name4
- NoteDoes not exhibit APOBEC1 complementation activity.
Q9NQ94-5
- Name5
- NoteDoes not exhibit APOBEC1 complementation activity.
- Differences from canonical
- 1-84: Missing
Q9NQ94-6
- Name6
- NoteMinor isoform found in 2-3% of cDNA clones.
- Differences from canonical
- 202-256: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_051926 | 1-33 | in isoform 3 | |||
Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MLCSPSFCKLCWKRKK | ||||||
Alternative sequence | VSP_051927 | 1-33 | in isoform 4 | |||
Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEK | ||||||
Alternative sequence | VSP_051925 | 1-84 | in isoform 5 | |||
Sequence: Missing | ||||||
Sequence conflict | 191 | in Ref. 2; AAF34824 | ||||
Sequence: A → T | ||||||
Alternative sequence | VSP_051928 | 202-256 | in isoform 6 | |||
Sequence: Missing | ||||||
Sequence conflict | 277 | in Ref. 2 and 3 | ||||
Sequence: E → K | ||||||
Alternative sequence | VSP_051929 | 381-388 | in isoform 2, isoform 3 and isoform 4 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ272078 EMBL· GenBank· DDBJ | CAB94754.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ272079 EMBL· GenBank· DDBJ | CAB94755.1 EMBL· GenBank· DDBJ | mRNA | ||
AF209192 EMBL· GenBank· DDBJ | AAF34824.1 EMBL· GenBank· DDBJ | mRNA | ||
AF271789 EMBL· GenBank· DDBJ | AAF76221.1 EMBL· GenBank· DDBJ | mRNA | ||
AF271790 EMBL· GenBank· DDBJ | AAF76222.1 EMBL· GenBank· DDBJ | mRNA | ||
AK000324 EMBL· GenBank· DDBJ | BAA91086.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AK291982 EMBL· GenBank· DDBJ | BAF84671.1 EMBL· GenBank· DDBJ | mRNA | ||
AL512366 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL589794 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471083 EMBL· GenBank· DDBJ | EAW54133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471083 EMBL· GenBank· DDBJ | EAW54134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471083 EMBL· GenBank· DDBJ | EAW54135.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC130519 EMBL· GenBank· DDBJ | AAI30520.1 EMBL· GenBank· DDBJ | mRNA | ||
BC144196 EMBL· GenBank· DDBJ | AAI44197.1 EMBL· GenBank· DDBJ | mRNA |