Q9NPI9 · KCJ16_HUMAN
- ProteinInward rectifier potassium channel 16
- GeneKCNJ16
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids418 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ16 may be involved in the regulation of fluid and pH balance. In the kidney, together with KCNJ10, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules (PubMed:24561201).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 161 | Role in the control of polyamine-mediated channel gating and in the blocking by intracellular magnesium | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | plasma membrane | |
Cellular Component | voltage-gated potassium channel complex | |
Molecular Function | inward rectifier potassium channel activity | |
Biological Process | potassium ion import across plasma membrane | |
Biological Process | potassium ion transport | |
Biological Process | regulation of monoatomic ion transmembrane transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameInward rectifier potassium channel 16
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9NPI9
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Note: In kidney distal convoluted tubules, located in the basolateral membrane in the presence of KCNJ10.
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-70 | Cytoplasmic | ||||
Sequence: MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKW | ||||||
Transmembrane | 71-95 | Helical; Name=M1 | ||||
Sequence: RHMFVIFSLSYILSWLIFGSVFWLI | ||||||
Topological domain | 96-117 | Extracellular | ||||
Sequence: AFHHGDLLNDPDITPCVDNVHS | ||||||
Intramembrane | 118-129 | Helical; Pore-forming; Name=H5 | ||||
Sequence: FTGAFLFSLETQ | ||||||
Intramembrane | 130-136 | Pore-forming | ||||
Sequence: TTIGYGY | ||||||
Topological domain | 137-145 | Extracellular | ||||
Sequence: RCVTEECSV | ||||||
Transmembrane | 146-167 | Helical; Name=M2 | ||||
Sequence: AVLMVILQSILSCIINTFIIGA | ||||||
Topological domain | 168-418 | Cytoplasmic | ||||
Sequence: ALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Hypokalemic tubulopathy and deafness (HKTD)
- Note
- DescriptionAn autosomal recessive disease characterized by renal tubulopathy with hypokalemia, salt wasting, disturbed acid-base homeostasis, and sensorineural deafness.
- See alsoMIM:619406
Natural variants in HKTD
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_085941 | 64 | T>I | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |
VAR_085942 | 132 | I>R | in HKTD; when coexpressed with KCNJ10 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |
VAR_085943 | 135 | G>A | in HKTD | |
VAR_085944 | 137 | R>C | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |
VAR_085945 | 176-418 | missing | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |
VAR_085946 | 250 | P>L | in HKTD; when coexpressed with KCNJ10 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_024510 | 11 | in dbSNP:rs9302912 | |||
Sequence: I → V | ||||||
Natural variant | VAR_085941 | 64 | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |||
Sequence: T → I | ||||||
Natural variant | VAR_085942 | 132 | in HKTD; when coexpressed with KCNJ10 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |||
Sequence: I → R | ||||||
Natural variant | VAR_085943 | 135 | in HKTD | |||
Sequence: G → A | ||||||
Natural variant | VAR_085944 | 137 | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |||
Sequence: R → C | ||||||
Natural variant | VAR_085945 | 176-418 | in HKTD; when coexpressed with KCNJ10 or KCNJ15 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |||
Sequence: Missing | ||||||
Natural variant | VAR_085946 | 250 | in HKTD; when coexpressed with KCNJ10 in Xenopus oocytes, it results in decreased channel expression at the surface and reduced potassium current amplitude compared to the wild-type | |||
Sequence: P → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 620 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000154975 | 1-418 | UniProt | Inward rectifier potassium channel 16 | |||
Sequence: MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM | |||||||
Modified residue | 373 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 373 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 375 | UniProt | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed, with highest levels in adult and fetal kidney (at protein level). In the kidney, expressed in the proximal and distal convoluted tubules, but not in glomeruli nor collecting ducts.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Heterodimer with Kir4.1/KCNJ10; this interaction is required for KCNJ16 localization to the basolateral membrane in kidney cells. As a heterodimer with KCNJ10, may interact with MAGI1; this interaction may facilitate KCNJ10/KCNJ16 potassium channel expression at the basolateral membrane in kidney cells (PubMed:24561201).
May form heterodimers with Kir2.1/KCNJ2 (Probable)
May form heterodimers with Kir2.1/KCNJ2 (Probable)
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 131-136 | Selectivity filter | ||||
Sequence: TIGYGY |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length418
- Mass (Da)47,949
- Last updated2000-10-01 v1
- Checksum1E241B4C15CBD264
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF179353 EMBL· GenBank· DDBJ | AAG09401.1 EMBL· GenBank· DDBJ | mRNA | ||
AF153814 EMBL· GenBank· DDBJ | AAF73244.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF153815 EMBL· GenBank· DDBJ | AAF73238.1 EMBL· GenBank· DDBJ | mRNA | ||
AF153816 EMBL· GenBank· DDBJ | AAF73239.1 EMBL· GenBank· DDBJ | mRNA | ||
AF153817 EMBL· GenBank· DDBJ | AAF73240.1 EMBL· GenBank· DDBJ | mRNA |