Q9NEL2 · SSL1_CAEEL
- ProteinHelicase ssl-1
- Genessl-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2395 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Probable catalytic component of a chromatin-remodeling complex which mediates the ATP-dependent exchange of histone H2A variant H2AV/htz-1 for H2A, leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in foregut development, and may be involved in vulval development.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Binding site | 583-590 | ATP (UniProtKB | ChEBI) | |||
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Swr1 complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | ATP-dependent chromatin remodeler activity | |
Molecular Function | DNA binding | |
Molecular Function | helicase activity | |
Molecular Function | histone binding | |
Biological Process | chromatin remodeling | |
Biological Process | negative regulation of cell fate specification |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHelicase ssl-1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9NEL2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Defects in feminization. Embryonic arrest.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Chain | PRO_0000311237 | 1-2395 | Helicase ssl-1 | ||
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain, coiled coil.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Compositional bias | 1-31 | Polar residues | |||
Region | 1-62 | Disordered | |||
Compositional bias | 48-62 | Basic and acidic residues | |||
Domain | 227-300 | HSA | |||
Region | 354-404 | Disordered | |||
Compositional bias | 363-404 | Basic and acidic residues | |||
Coiled coil | 388-464 | ||||
Compositional bias | 444-469 | Basic and acidic residues | |||
Region | 444-504 | Disordered | |||
Compositional bias | 470-491 | Polar residues | |||
Domain | 570-735 | Helicase ATP-binding | |||
Region | 963-982 | Disordered | |||
Domain | 1196-1342 | Helicase C-terminal | |||
Coiled coil | 1452-1476 | ||||
Compositional bias | 1615-1670 | Polar residues | |||
Region | 1615-1706 | Disordered | |||
Compositional bias | 1977-2041 | Polar residues | |||
Region | 1977-2073 | Disordered | |||
Compositional bias | 2050-2073 | Polar residues | |||
Region | 2092-2143 | Disordered | |||
Region | 2276-2306 | Disordered | |||
Compositional bias | 2350-2385 | Polar residues | |||
Region | 2350-2395 | Disordered | |||
Sequence similarities
Belongs to the SNF2/RAD54 helicase family. SWR1 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9NEL2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length2,395
- Mass (Da)268,727
- Last updated2006-06-13 v4
- MD5 Checksum56DBCE1671F32F6D7B446B0538F36A5A
Q9NEL2-2
- Nameb
- Differences from canonical
- 1512-1920: IKFYDELDDIMPIWLPPSPPDSDADFDLRMEDDCLDLMYEIEQMNEARLPQVCHEMRRPLAEKQQKQNTLNAFNDILSAKEKESVYDAVNKCLQMPQSEAITAESAASPAYTEHSSFSMDDTSQDAKIEPSLTENQQPTTTATTTTTVPQQQQQQQQQKSSKKKRNDNRTAQNRTAENGVKRATTPPPSWREEPDYDGAEWNIVEDYALLQAVQVEFANAHLVEKSANEGMVLNWEFVSNAVNKQTRFFRSARQCSIRYQMFVRPKELGQLVASDPISKKTMKVDLSHTELSHLRKGRMTTESQYAHDYGILTDKKHVNRFKSVRVAATRRPVQFWRGPKALESRNLQSLNGGMPPRHESRLAEFDVKTNIRLDAEDIVTMSDESIVAYEASKKKLLASRQTKPSPRQD → VRDRRRRSSSLLQKAAQKPAKKPQNFQIRARSPSKRKSQAPSFDPYVSYAPHALASPPDSPRKRRSRGARSLGSGGGGGGGSRSVGRPARRSVKKEESDDDDEDYCQEEEVKRNPAEKVPPKRKRVVFVEPPEVKPPEPKKRVVVPAPSSSSSALTTLPQQGPLISLPKAVPVVPRPQQQAPPQLIKKHQQTLMPVKVLKISGGGGGTPGPSSVSPGPSILRRTVVPGIGAGGVGRLPLVRMPVRPPFPGSQAPAPPLRSGVAPTAPAAAPRQFVVPSSRVRVITTRTPVATTMVQQQQSPSPLMFPVRVVQRPGPSGPPPPGPPDRPGFGIYEKPRFSLGSRRSRGDSGPEDPAPPQPPPPTTSRPPPQA
- 1921-2395: Missing
Q9NEL2-3
- Namec
- Differences from canonical
- 1-1521: Missing
Q9NEL2-4
- Named
- Differences from canonical
- 1-146: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Compositional bias | 1-31 | Polar residues | |||
Alternative sequence | VSP_043686 | 1-146 | in isoform d | ||
Alternative sequence | VSP_043685 | 1-1521 | in isoform c | ||
Compositional bias | 48-62 | Basic and acidic residues | |||
Compositional bias | 363-404 | Basic and acidic residues | |||
Compositional bias | 444-469 | Basic and acidic residues | |||
Compositional bias | 470-491 | Polar residues | |||
Alternative sequence | VSP_043687 | 1512-1920 | in isoform b | ||
Compositional bias | 1615-1670 | Polar residues | |||
Alternative sequence | VSP_043688 | 1921-2395 | in isoform b | ||
Compositional bias | 1977-2041 | Polar residues | |||
Compositional bias | 2050-2073 | Polar residues | |||
Compositional bias | 2350-2385 | Polar residues | |||
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY551965 EMBL· GenBank· DDBJ | AAS65429.1 EMBL· GenBank· DDBJ | mRNA | ||
AL132904 EMBL· GenBank· DDBJ | CAC35851.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132904 EMBL· GenBank· DDBJ | CBW48563.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132904 EMBL· GenBank· DDBJ | CBW48564.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132904 EMBL· GenBank· DDBJ | CBW48565.1 EMBL· GenBank· DDBJ | Genomic DNA |