Q9NAH6 · KS6B_CAEEL
- ProteinRibosomal protein S6 kinase beta
- Genersks-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids550 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Serine/threonine-protein kinase which regulates mRNA translation (PubMed:17266680).
Negatively regulates lifespan and resistance to starvation, oxidative stress, protein aggregation and P.aeruginosa-mediated infection (PubMed:17266680, PubMed:23879233, PubMed:24332851).
May regulate these processes by preventing the activation of transcription factor hif-1 (PubMed:23879233).
Required, probably downstream of let-363/TOR, for the establishment of the proper number of germline progenitors by promoting cell cycle progression and preventing differentiation during larval development. Regulates germ cell size (PubMed:22278922).
In addition required for sperm production and embryo viability (PubMed:17266680, PubMed:22278922).
Involved in axon regeneration of PLM and ALM neurons by inhibiting growth cone formation early after axotomy and later by inhibiting axon extension. Functions in axon regeneration and lifespan probably by preventing aak-2/AMPK activation (PubMed:24332851, PubMed:24431434).
Negatively regulates autophagy (PubMed:22560223).
Negatively regulates lifespan and resistance to starvation, oxidative stress, protein aggregation and P.aeruginosa-mediated infection (PubMed:17266680, PubMed:23879233, PubMed:24332851).
May regulate these processes by preventing the activation of transcription factor hif-1 (PubMed:23879233).
Required, probably downstream of let-363/TOR, for the establishment of the proper number of germline progenitors by promoting cell cycle progression and preventing differentiation during larval development. Regulates germ cell size (PubMed:22278922).
In addition required for sperm production and embryo viability (PubMed:17266680, PubMed:22278922).
Involved in axon regeneration of PLM and ALM neurons by inhibiting growth cone formation early after axotomy and later by inhibiting axon extension. Functions in axon regeneration and lifespan probably by preventing aak-2/AMPK activation (PubMed:24332851, PubMed:24431434).
Negatively regulates autophagy (PubMed:22560223).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | cytoplasm | |
Cellular Component | nucleoplasm | |
Cellular Component | perikaryon | |
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | determination of adult lifespan | |
Biological Process | nematode larval development | |
Biological Process | positive regulation of autophagosome assembly | |
Biological Process | positive regulation of gene expression | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibosomal protein S6 kinase beta
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9NAH6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Enriched in the synaptic branch of PLM neurons.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown causes an increased lifespan and resistance to starvation, slower growth and a decrease in brood size (PubMed:17266680).
Causes a decrease in the number of germline progenitors (PubMed:22278922).
RNAi-mediated knockdown in adults causes increase in lgg-1 positive autophagic vesicles (PubMed:22560223).
RNAi-mediated knockdown in a daf-2 e1370 mutant background results in daf-16-mediated up-regulation of stdh-1 reporter expression in the intestine and a synergistic increase in lifespan. RNAi-mediated knockdown in germ line, hypodermis and to a lesser extent in intestine and daf-2 e1370 mutant background causes a synergistic increase in lifespan (PubMed:24332851).
Causes a decrease in the number of germline progenitors (PubMed:22278922).
RNAi-mediated knockdown in adults causes increase in lgg-1 positive autophagic vesicles (PubMed:22560223).
RNAi-mediated knockdown in a daf-2 e1370 mutant background results in daf-16-mediated up-regulation of stdh-1 reporter expression in the intestine and a synergistic increase in lifespan. RNAi-mediated knockdown in germ line, hypodermis and to a lesser extent in intestine and daf-2 e1370 mutant background causes a synergistic increase in lifespan (PubMed:24332851).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 115 | Probable loss of kinase activity. Enhanced axonal regrowth following axotomy of PLM neurons. | ||||
Sequence: K → Q | ||||||
Mutagenesis | 404 | Abolishes phosphorylation and causes a decrease in the number of germline progenitors. | ||||
Sequence: T → A | ||||||
Mutagenesis | 404 | Phosphomimetic mutant which inhibits axon regrowth following axotomy of PLM neurons. | ||||
Sequence: T → E | ||||||
Mutagenesis | 439 | Phosphomimetic mutant which inhibits axon regrowth following axotomy of PLM neurons. | ||||
Sequence: S → D |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000435314 | 1-550 | Ribosomal protein S6 kinase beta | |||
Sequence: MADVFEFELEGHESQASPQRHAYHYDNCTEIMEDDHMYSNVADGQISAPPPSSSYMEDPMMESIQLCASAINPPNVRVGPEDFQLLKVLGKGGYGKVFQVRKTTGSDNGQIFAMKVLQKATIVRNQKDTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQKTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAENRRKTIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTDWNLVYARQLEAPFKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNPFVGFTYVAPSVLEMMNKGGHGGISVAHLASSMSRAGAAKSPRKPGDPETASILHGGHSNLFGHGPNSEAPQAFGYGIGSQMTTTTAGGAGIQQPYQSFSGGYPEDDAMDTSTPRASESRETTTGNGSTTTTRPSNVGSSASTPIPLPKRVM | ||||||
Modified residue | 404 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 439 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
May be phosphorylated on Thr-404 by let-363/TOR.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 83-344 | Protein kinase | ||||
Sequence: FQLLKVLGKGGYGKVFQVRKTTGSDNGQIFAMKVLQKATIVRNQKDTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQKTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAENRRKTIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFF | ||||||
Domain | 345-415 | AGC-kinase C-terminal | ||||
Sequence: KTTDWNLVYARQLEAPFKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNPFVGFTYVAPSVLEMMN | ||||||
Region | 433-466 | Disordered | ||||
Sequence: RAGAAKSPRKPGDPETASILHGGHSNLFGHGPNS | ||||||
Compositional bias | 484-498 | Polar residues | ||||
Sequence: TAGGAGIQQPYQSFS | ||||||
Region | 484-550 | Disordered | ||||
Sequence: TAGGAGIQQPYQSFSGGYPEDDAMDTSTPRASESRETTTGNGSTTTTRPSNVGSSASTPIPLPKRVM | ||||||
Compositional bias | 513-541 | Polar residues | ||||
Sequence: RASESRETTTGNGSTTTTRPSNVGSSAST |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length550
- Mass (Da)60,424
- Last updated2012-03-21 v2
- ChecksumD207B4760CBCDC42
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 484-498 | Polar residues | ||||
Sequence: TAGGAGIQQPYQSFS | ||||||
Compositional bias | 513-541 | Polar residues | ||||
Sequence: RASESRETTTGNGSTTTTRPSNVGSSAST |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284603 EMBL· GenBank· DDBJ | CAB55075.2 EMBL· GenBank· DDBJ | Genomic DNA |