Q9N9H4 · ASP2_NECAM
- ProteinAspartic protease 2
- Geneapr-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids425 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Aspartic protease which cleaves several human serum proteins including hemoglobin, fibrinogen and albumin. Appears to cleave preferentially between P1 (Ala, Leu, Val, Phe and Gly) and P1' (Ala and Leu) residues.
Activity regulation
Inhibited by pepstatin A.
pH Dependence
Optimum pH is 5.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 90 | |||||
Sequence: D | ||||||
Active site | 316 | |||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | lysosome | |
Molecular Function | aspartic-type endopeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAspartic protease 2
- EC number
- Short namesNa-APR-2
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Strongyloidea > Ancylostomatidae > Bunostominae > Necator
Accessions
- Primary accessionQ9N9H4
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted into the gut lumen.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MRSILVLVALIGCIAA | ||||||
Chain | PRO_5004330323 | 17-425 | Aspartic protease 2 | |||
Sequence: GVYKIPLKRITPPMIKMLRAGTWETYVEGMRKRQLQLLKEHKVHIQDVLGYANMEYLGEITIGTPQQKFLVVLDTGSSNLWVPDDSCYKEKRPDRCLVSNCDAGLVCQVFCPDPKCCEHTREFKQVNACKDKHRFDQKNSNTYVKTNKTWAIAYGTGDARGFFGRDTVRLGAEGKDQLVINDTWFGQAEHIAEFFSNTFLDGILGLAFQELSEGGVAPPIIRAIDLGLLDQPIFTVYFENVGDKEGVYGGVFTWGGLDPDHCEDEVTYEQLTEATYWQFRLKGVSSKNFSSTAGWEAISDTGTSLNGAPRGILRSIARQYNGQYVASQGLYVVDCSKNVTVDVTIGDRNYTMTAKNLVLEIQADICIMAFFEMDMFIGPAWILGDPFIREYCNIHDIEKKRIGFAAVKH | ||||||
Disulfide bond | 103↔145 | |||||
Sequence: CYKEKRPDRCLVSNCDAGLVCQVFCPDPKCCEHTREFKQVNAC | ||||||
Glycosylation | 163 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 197 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 304 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 351↔382 | |||||
Sequence: CSKNVTVDVTIGDRNYTMTAKNLVLEIQADIC | ||||||
Glycosylation | 354 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 365 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Cleaved into a mature form.
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Expressed in intestine, amphidal glands and excretory gland (at protein level).
Developmental stage
Expressed at the L4 larval stage and in adults. Not expressed at the L3 infective larval stage.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 72-421 | Peptidase A1 | ||||
Sequence: YLGEITIGTPQQKFLVVLDTGSSNLWVPDDSCYKEKRPDRCLVSNCDAGLVCQVFCPDPKCCEHTREFKQVNACKDKHRFDQKNSNTYVKTNKTWAIAYGTGDARGFFGRDTVRLGAEGKDQLVINDTWFGQAEHIAEFFSNTFLDGILGLAFQELSEGGVAPPIIRAIDLGLLDQPIFTVYFENVGDKEGVYGGVFTWGGLDPDHCEDEVTYEQLTEATYWQFRLKGVSSKNFSSTAGWEAISDTGTSLNGAPRGILRSIARQYNGQYVASQGLYVVDCSKNVTVDVTIGDRNYTMTAKNLVLEIQADICIMAFFEMDMFIGPAWILGDPFIREYCNIHDIEKKRIGFA |
Sequence similarities
Belongs to the peptidase A1 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length425
- Mass (Da)47,650
- Last updated2000-10-01 v1
- ChecksumBEC8F83489306DF4