Q9N3Q4 · ATM_CAEEL
- ProteinSerine/threonine-protein kinase ATM
- Geneatm-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2378 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Serine/threonine protein kinase which activates checkpoint signaling in the presence of DNA double strand breaks (DSBs) and other forms of DNA damage induced by ionizing radiation and other genotoxic stresses such as UV. Plays a role in maintaining genome stability.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | DNA repair | |
Biological Process | response to ionizing radiation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein kinase ATM
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9N3Q4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Increased sensitivity to ionizing radiation with reduced survival compared to wild-type animals. Loss of induction of apoptosis following UV-C or ionizing radiation treatment but no effect on apoptotic response induced by X-ray exposure. Low brood size, reduced viability and sterility, appearance of a high-incidence-of-males (Him) phenotype, and reduced chromosome number due to chromosome fusions.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000396514 | 1-2378 | Serine/threonine-protein kinase ATM | |||
Sequence: MSVTQLKNLKHAIAQLLEWDGTKTARKKIVDEVVLLYHALGAEALSEDNQEIYDLYDLSARIFNLAKKEIEEANQQFEKERKKGTRRSEKPVPTPLFELSIQHLKRCCQQGIDHNQVPWIAYCLKLLEFPITITEKSIENEISNVLLLSSNASQLHWAEHAHLSSLWKWIWSRVETADIGALAMRNYMELAANLLENVDYVVFEKSPIDLMAKVMGTLKKSVEMGNPKEYWCHYRKFSVVHILSYIVHRWGLEARDFILREIFELTGSLSNLISVAHKDGEQSKKCIMRLIDDLVKLAMIETVHGHRTMNEVTRGNIQKLVKTGIQESLKSAHRNFSRSSTFSISEECVRYLTRWLLAERRLEQPSAAMNESFELTGDSSSKKKDDATFDSLIDLSFGSTISGKHKLNAWNGVMQILNELLKSRRLELQVTEKIVTILWEKRKSYTTEPLRTVFCSILSTVVCQADVRFGHRKVPTIDSILKYSLSLMPNVASLPSAAALTETIVRFRTVSREGLRNTWDTVSRTSSGSFEVVRLISALISVTEFDENSRFANDERVRSWSFRKDIIEWVLLDPNAHSHKLLYQLCQYHPTYCYESEASSSDDSLLQTLKLCKLACSPAPPSAPKALRPLEASIEEIVRYVHDKLKSILATEITLPAFVLCHEFALKYPDRSYEFNKMYKKLYQIMEDQEEDEFLQSARHFSKWPQNLTLPIQKQTINCMAVFFEANLDNQLVDLCQWSDRRKVLVEMLAELAATRSEIRDKLQKSMPFNKFVKECIMENRGDLYEMTKRFEKYSFLLSIRNLIVTRMIITNEAARLLGDGETISETDIFIIEKRTLSTCIRNVSEGKELSGYTLDPYTVAANVHNVHFDHINVEIYLELLKKSPFFAQNIVRHLLRQNGKEAEEETWHLHATVLKIVMKDEKLLAVCVATIPNMVRYLKVYQIHFSPKSNAAKFLHLDMESISHCQSYLRKPTKSSNLITAANFLTLFGCEKRTWKRPILRFWSIFKQQPAMCCEKLLIFAEECVELGLNHRIACLLRALTTSEFCRKALCDEYLKIAFQLTYRSIFLILSKNECRPEIVELCDDMNLRYDLLQHQIKHVAAHHLEHFERFETKIAFSVEKFLKSGIDGIDFEDLGLVEFYKQLNENLTEDAIRSNEARNIYIVDILSTIWLQLPSIRPQILPILARFKHISPAWTNFPQPPHISTNEKSFLQHLRFHLYLKMMNISKSMTQGEYATCIMMLLTSYDSSHFVADLIEKKQLGKLKLQQRRNVLCILSRLLKDQAVMGDEDETIIDPILFKAITKASAVFEDTAACIVPFLFKICVDFKGKYDKCVINLLGCLKGVNAEDEIVVRCLAECVDSIGLNVIARYERLNIETHSEFGVKWFFKLSRLFLKHGFTTHSFAIANILFDRLSARKRNTMMIDRTSLDRIDRSQELINLLVEIYVAEGNSVALSSLPPAVQNRPDVRQVMNKSSKEWLKLLSSNQMDSWELTIVQWMCGIQFNAITGDKYLNSILRCNFNEYTKKIDSPLKFVYFQLFHLSTSTLEIEEAISSMPLAPTIDQMRLMIIANATASFEPQSVEEHVVRAVRELRETSNRRKSGGNVKGINEKTTRMVKLAEMLTENKAYDAAINLLDTWEHECLQWTSVAAESIDIDLIRICKQHVTCRSGDPRMADINLRTMHPRVPVMSDLAIAEWSLALSKITIEYRNDMEEGIRILEFGCKHLQNKDSVETRLKVLLKLHSVCIGQLSKLEEYRETRTYRMKQQAVTAFEQQIQNSCRTSLARGNSGDEWTKKTVQRVRKEHQFEKNDLEKVDNSLNSAARKAVSSGFDALLCISQLEDDDEAIRASSLIIFPLIDVIYKYETDVGVIALLKEHTKSKLPSKLWISATSHIASKCFSIEKSQITRHLSQILCHLIYDYPYHVLHTILMYDDEKNASKVKGFLKTIFDARADQRDSSKLKEIVITIREAHQAYREIAMLDVRGNVRIQRVEINGKTMYRWPHDLKIFKCKLRQLPIPTISQKIGCPGDYSTTDLITWKRWKDVFTIADGISTPKIWEIEGSDGKWYKTVWKKDDVRQDVLVEQMFDVTNNMLEKAMLRTYNVVPLDTECGVIEFCGGTVSLKEVMCGVTREGGLHREFNSEEVSASKVSSMMRQVQTESTETRRQVFVEICQQYSPVFRHFFYTNFSTAQIWRQKIINYRQSLATWSIVCYIVGLGDRHASNILFDQKLCTFVHIDLGMILEYSKRTLPVPEQVPFRITRDVLDPILIEGIENGQLAEECTQIMEKLKENGKVILGVASALLRETMTNFREAEQAAGRPSYISEMAIGRLREKLRGTDDGVTAQSSNLQIRRLLREATSADNLSRMFCGWMPFL |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1415-1937 | FAT | ||||
Sequence: LSARKRNTMMIDRTSLDRIDRSQELINLLVEIYVAEGNSVALSSLPPAVQNRPDVRQVMNKSSKEWLKLLSSNQMDSWELTIVQWMCGIQFNAITGDKYLNSILRCNFNEYTKKIDSPLKFVYFQLFHLSTSTLEIEEAISSMPLAPTIDQMRLMIIANATASFEPQSVEEHVVRAVRELRETSNRRKSGGNVKGINEKTTRMVKLAEMLTENKAYDAAINLLDTWEHECLQWTSVAAESIDIDLIRICKQHVTCRSGDPRMADINLRTMHPRVPVMSDLAIAEWSLALSKITIEYRNDMEEGIRILEFGCKHLQNKDSVETRLKVLLKLHSVCIGQLSKLEEYRETRTYRMKQQAVTAFEQQIQNSCRTSLARGNSGDEWTKKTVQRVRKEHQFEKNDLEKVDNSLNSAARKAVSSGFDALLCISQLEDDDEAIRASSLIIFPLIDVIYKYETDVGVIALLKEHTKSKLPSKLWISATSHIASKCFSIEKSQITRHLSQILCHLIYDYPYHVLHTILMYDDE | ||||||
Domain | 2044-2366 | PI3K/PI4K catalytic | ||||
Sequence: WKDVFTIADGISTPKIWEIEGSDGKWYKTVWKKDDVRQDVLVEQMFDVTNNMLEKAMLRTYNVVPLDTECGVIEFCGGTVSLKEVMCGVTREGGLHREFNSEEVSASKVSSMMRQVQTESTETRRQVFVEICQQYSPVFRHFFYTNFSTAQIWRQKIINYRQSLATWSIVCYIVGLGDRHASNILFDQKLCTFVHIDLGMILEYSKRTLPVPEQVPFRITRDVLDPILIEGIENGQLAEECTQIMEKLKENGKVILGVASALLRETMTNFREAEQAAGRPSYISEMAIGRLREKLRGTDDGVTAQSSNLQIRRLLREATSADN | ||||||
Region | 2050-2056 | G-loop | ||||
Sequence: IADGIST | ||||||
Region | 2218-2226 | Catalytic loop | ||||
Sequence: GLGDRHASN | ||||||
Region | 2238-2263 | Activation loop | ||||
Sequence: HIDLGMILEYSKRTLPVPEQVPFRIT | ||||||
Domain | 2346-2378 | FATC | ||||
Sequence: TAQSSNLQIRRLLREATSADNLSRMFCGWMPFL |
Sequence similarities
Belongs to the PI3/PI4-kinase family. ATM subfamily.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9N3Q4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length2,378
- Mass (Da)273,957
- Last updated2014-07-09 v3
- ChecksumBB646EBBB3B1D8E2
Q9N3Q4-2
- Nameb
- Differences from canonical
- 1-677: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_055333 | 1-677 | in isoform b | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO081620 EMBL· GenBank· DDBJ | CDK13475.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO081456 EMBL· GenBank· DDBJ | CDK13475.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO081488 EMBL· GenBank· DDBJ | CDK13475.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO081620 EMBL· GenBank· DDBJ | CDK13476.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO081488 EMBL· GenBank· DDBJ | CDK13476.1 EMBL· GenBank· DDBJ | Genomic DNA |