Q9N0C7 · EPDR1_MACFA
- ProteinMammalian ependymin-related protein 1
- GeneEPDR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids224 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Binds anionic lipids and gangliosides at acidic pH.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | lysosomal lumen | |
Molecular Function | calcium ion binding | |
Molecular Function | lipid binding | |
Biological Process | cell-matrix adhesion |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameMammalian ependymin-related protein 1
- Short namesMERP-1
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Cercopithecinae > Macaca
Accessions
- Primary accessionQ9N0C7
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Lysosomal and also secreted.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-37 | |||||
Sequence: MPGRAPLHTVPGALGPWLLGCLWAWTLCGLCSLGAVG | ||||||
Chain | PRO_0000008352 | 38-224 | Mammalian ependymin-related protein 1 | |||
Sequence: APRPCQAPQQWEGRQVMYQQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIEQATKQCSKMTLTEPWDPLDIPQNSTFEDQYSIGGPQEQIMVQEWSDRKSARSYETWIGIYTVKDCYPVQETFTKNYSVILSTRFFDIQLGIKDPSVFTPPSTCQIAQLEKMSEDCSW | ||||||
Disulfide bond | 42↔172 | |||||
Sequence: CQAPQQWEGRQVMYQQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIEQATKQCSKMTLTEPWDPLDIPQNSTFEDQYSIGGPQEQIMVQEWSDRKSARSYETWIGIYTVKDC | ||||||
Disulfide bond | 88↔222 | |||||
Sequence: CKRLFEYILLYKDGVMFQIEQATKQCSKMTLTEPWDPLDIPQNSTFEDQYSIGGPQEQIMVQEWSDRKSARSYETWIGIYTVKDCYPVQETFTKNYSVILSTRFFDIQLGIKDPSVFTPPSTCQIAQLEKMSEDC | ||||||
Disulfide bond | 113↔210 | |||||
Sequence: CSKMTLTEPWDPLDIPQNSTFEDQYSIGGPQEQIMVQEWSDRKSARSYETWIGIYTVKDCYPVQETFTKNYSVILSTRFFDIQLGIKDPSVFTPPSTC | ||||||
Glycosylation | 130 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 182 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
N-glycosylated; the glycan contains mannose-6-phosphate moieties.
Keywords
- PTM
PTM databases
Interaction
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length224
- Mass (Da)25,532
- Last updated2008-03-18 v3
- Checksum358E80B615AB4BB7
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 47 | in Ref. 1; BAB60800 and 2; BAC41745 | ||||
Sequence: Q → L | ||||||
Sequence conflict | 76 | in Ref. 1; BAB62213 | ||||
Sequence: V → L | ||||||
Sequence conflict | 191 | in Ref. 1; BAB01585 | ||||
Sequence: F → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB046003 EMBL· GenBank· DDBJ | BAB01585.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB063094 EMBL· GenBank· DDBJ | BAB60800.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB066537 EMBL· GenBank· DDBJ | BAB62213.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AB097520 EMBL· GenBank· DDBJ | BAC41745.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |