Q9MEG4 · Q9MEG4_IPSPI
- ProteinCytochrome c oxidase subunit 1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids117 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Catalytic activity
- 4 Fe(II)-[cytochrome c] + 8 H+(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H+(out) + 2 H2OThis reaction proceeds in the forward direction.
4 RHEA-COMP:10350 + 8 H+ (in)CHEBI:15378+ CHEBI:15379 = 4 RHEA-COMP:14399 + 4 H+ (out)CHEBI:15378+ 2 CHEBI:15377
Cofactor
Pathway
Energy metabolism; oxidative phosphorylation.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial respiratory chain complex IV | |
Molecular Function | cytochrome-c oxidase activity | |
Molecular Function | heme binding | |
Molecular Function | metal ion binding | |
Biological Process | electron transport coupled proton transport | |
Biological Process | mitochondrial electron transport, cytochrome c to oxygen |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 1
- EC number
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Coleoptera > Polyphaga > Cucujiformia > Curculionidae > Scolytinae > Ips
Accessions
- Primary accessionQ9MEG4
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 20-43 | Helical | ||||
Sequence: FGVLGMIYAMTAIGLLGFVVWAHH | ||||||
Transmembrane | 55-79 | Helical | ||||
Sequence: AYFTSATMIIAVPTGIKIFSWLATF | ||||||
Transmembrane | 91-111 | Helical | ||||
Sequence: LWSLGFIFLFTMGGLTGVILA |
Keywords
- Cellular component
Interaction
Subunit
Component of the cytochrome c oxidase (complex IV, CIV), a multisubunit enzyme composed of a catalytic core of 3 subunits and several supernumerary subunits. The complex exists as a monomer or a dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-117 | Cytochrome oxidase subunit I profile | ||||
Sequence: PGFGLISHIISQESGKKEAFGVLGMIYAMTAIGLLGFVVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATFHGAQISFNPSSLWSLGFIFLFTMGGLTGVILANSSIDI |
Sequence similarities
Belongs to the heme-copper respiratory oxidase family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length117
- Mass (Da)12,565
- Last updated2000-10-01 v1
- Checksum06BC2A46FBEE0A42
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: P | ||||||
Non-terminal residue | 117 | |||||
Sequence: I |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF160830 EMBL· GenBank· DDBJ | AAF80414.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160831 EMBL· GenBank· DDBJ | AAF80415.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160832 EMBL· GenBank· DDBJ | AAF80416.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160833 EMBL· GenBank· DDBJ | AAF80417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160834 EMBL· GenBank· DDBJ | AAF80418.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160835 EMBL· GenBank· DDBJ | AAF80419.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160836 EMBL· GenBank· DDBJ | AAF80420.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160837 EMBL· GenBank· DDBJ | AAF80421.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160838 EMBL· GenBank· DDBJ | AAF80422.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160839 EMBL· GenBank· DDBJ | AAF80423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160840 EMBL· GenBank· DDBJ | AAF80424.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160841 EMBL· GenBank· DDBJ | AAF80425.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160842 EMBL· GenBank· DDBJ | AAF80426.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160843 EMBL· GenBank· DDBJ | AAF80427.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160844 EMBL· GenBank· DDBJ | AAF80428.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160845 EMBL· GenBank· DDBJ | AAF80429.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160846 EMBL· GenBank· DDBJ | AAF80430.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160847 EMBL· GenBank· DDBJ | AAF80431.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160848 EMBL· GenBank· DDBJ | AAF80432.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160849 EMBL· GenBank· DDBJ | AAF80433.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160850 EMBL· GenBank· DDBJ | AAF80434.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160851 EMBL· GenBank· DDBJ | AAF80435.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160853 EMBL· GenBank· DDBJ | AAF80437.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160854 EMBL· GenBank· DDBJ | AAF80438.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160855 EMBL· GenBank· DDBJ | AAF80439.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160856 EMBL· GenBank· DDBJ | AAF80440.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160857 EMBL· GenBank· DDBJ | AAF80441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160858 EMBL· GenBank· DDBJ | AAF80442.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160859 EMBL· GenBank· DDBJ | AAF80443.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160860 EMBL· GenBank· DDBJ | AAF80444.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160861 EMBL· GenBank· DDBJ | AAF80445.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160862 EMBL· GenBank· DDBJ | AAF80446.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF160863 EMBL· GenBank· DDBJ | AAF80447.1 EMBL· GenBank· DDBJ | Genomic DNA |