Q9M8S0 · MBS1_ARATH
- ProteinProtein METHYLENE BLUE SENSITIVITY 1
- GeneMBS1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids105 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Required for acclimation to reactive oxygen species (ROS) responses downstream of beta-cyclocitral (beta-cc) or mediated by dihydroactinidiolide, including singlet oxygen 1O2 detoxification reactions, especially upon light-mediated photooxidative stress, and leading to programmed cell death (PubMed:24151292, PubMed:27813110).
Prevents leaf senescence (PubMed:24151292).
Involved in cold acclimation (PubMed:27813110).
Prevents leaf senescence (PubMed:24151292).
Involved in cold acclimation (PubMed:27813110).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic stress granule | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | cellular response to singlet oxygen | |
Biological Process | cold acclimation | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of leaf senescence | |
Biological Process | response to high light intensity | |
Biological Process | response to photooxidative stress |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein METHYLENE BLUE SENSITIVITY 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M8S0
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Normal plants under standard growth conditions, but severe symptoms of photooxidative damage under excess light due to a deficient induction of singlet oxygen 1O2 detoxification reactions, thus leading to pale leaf phenotype, early senescence and lack of anthocyanin accumulation (PubMed:24151292, PubMed:27813110).
Increased susceptibility to low temperatures and high photon flux density (PFD) conditions. Increased lipid peroxidation in response to beta-cyclocitral (beta-cc) associated with reduced induction of reactive oxygen species (ROS) responsive genes (e.g. AAA, LTI30, ZAT12 and WRKY40). Altered induction of gene (e.g. AAA, OXI1, CAT2, APX1 and RD20) expression in response to the lactone dihydroactinidiolide (PubMed:27813110).
Accumulation of singlet oxygen 1O2 in chloroplasts in response to light stress. Early senescence of the older leaves. Plants lacking both MBS1 and MBS2 exhibit premature leaf senescence (PubMed:24151292).
Increased susceptibility to low temperatures and high photon flux density (PFD) conditions. Increased lipid peroxidation in response to beta-cyclocitral (beta-cc) associated with reduced induction of reactive oxygen species (ROS) responsive genes (e.g. AAA, LTI30, ZAT12 and WRKY40). Altered induction of gene (e.g. AAA, OXI1, CAT2, APX1 and RD20) expression in response to the lactone dihydroactinidiolide (PubMed:27813110).
Accumulation of singlet oxygen 1O2 in chloroplasts in response to light stress. Early senescence of the older leaves. Plants lacking both MBS1 and MBS2 exhibit premature leaf senescence (PubMed:24151292).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 9 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444900 | 1-105 | Protein METHYLENE BLUE SENSITIVITY 1 | |||
Sequence: MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPGLKTMQIHHESKHPNIIYEESKLVNLHAVLAPVAESKPKPGIRGSLKK |
Proteomic databases
PTM databases
Structure
Sequence
- Sequence statusComplete
- Length105
- Mass (Da)11,278
- Last updated2000-10-01 v1
- Checksum4F882E77711B5514
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC018363 EMBL· GenBank· DDBJ | AAF26981.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE73860.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF361599 EMBL· GenBank· DDBJ | AAK32767.1 EMBL· GenBank· DDBJ | mRNA | ||
AY058229 EMBL· GenBank· DDBJ | AAL15403.1 EMBL· GenBank· DDBJ | mRNA |