Q9M881 · STAD2_ARATH
- ProteinStearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic
- GeneS-ACP-DES2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids411 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons 9 and 10 of the acyl chain (By similarity).
Exhibits delta-9 palmitoyl-[acyl-carrier-protein] desaturase (PAD) activity. Involved in omega-7 monounsaturated fatty acid biosynthesis, especially in the endosperm oil (PubMed:27681170).
Exhibits delta-9 palmitoyl-[acyl-carrier-protein] desaturase (PAD) activity. Involved in omega-7 monounsaturated fatty acid biosynthesis, especially in the endosperm oil (PubMed:27681170).
Catalytic activity
- 2 H+ + O2 + octadecanoyl-[ACP] + 2 reduced [2Fe-2S]-[ferredoxin] = (9Z)-octadecenoyl-[ACP] + 2 H2O + 2 oxidized [2Fe-2S]-[ferredoxin]
2 CHEBI:15378 + CHEBI:15379 + RHEA-COMP:9656 + 2 RHEA-COMP:10001 = RHEA-COMP:9924 + 2 CHEBI:15377 + 2 RHEA-COMP:10000
Cofactor
Note: Binds 2 Fe2+ ions per subunit.
Pathway
Lipid metabolism; fatty acid metabolism.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 148 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 186 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 186 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 189 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 224 | Confers substrate specificity | ||||
Sequence: F | ||||||
Binding site | 239 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 272 | Fe cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 272 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 275 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | acyl-[acyl-carrier-protein] desaturase activity | |
Molecular Function | metal ion binding | |
Molecular Function | stearoyl-[acp] desaturase activity | |
Biological Process | fatty acid homeostasis | |
Biological Process | fatty acid metabolic process | |
Biological Process | regulation of endosperm development | |
Biological Process | unsaturated fatty acid biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameStearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic
- EC number
- Short namesStearoyl-ACP desaturase 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M881
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Reduced omega-7 fatty acids accumulation in the endosperm. The endosperm oil of double mutant aad2-3 aad3-3 lacks omega-7 fatty acids.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 38 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-44 | Chloroplast | ||||
Sequence: MALLLNSTITVAMKQNPLVAVSFPRTTCLGSSFSPPRLLRVSCV | ||||||
Chain | PRO_0000401420 | 45-411 | Stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic | |||
Sequence: ATNPSKTSEETDKKKFRPIKEVPNQVTHTITQEKLEIFKSMENWAQENLLSYLKPVEASWQPQDFLPETNDEDRFYEQVKELRDRTKEIPDDYFVVLVGDMITEEALPTYQTTLNTLDGVKDETGGSLTPWAVWVRAWTAEENRHGDLLNKYLYLSGRVDMRHVEKTIQYLIGSGMDSKFENNPYNGFIYTSFQERATFISHGNTAKLATTYGDTTLAKICGTIAADEKRHETAYTRIVEKLFEIDPDGTVQALASMMRKRITMPAHLMHDGRDDDLFDHYAAVAQRIGVYTATDYAGILEFLLRRWEVEKLGMGLSGEGRRAQDYLCTLPQRIRRLEERANDRVKLASKSKPSVSFSWIYGREVEL |
Proteomic databases
Expression
Tissue specificity
Preferentially expressed in roots and flowers.
Induction
Activated by MYB115 and MYB118 in the endosperm.
Developmental stage
Accumulates in maturing endosperm.
Gene expression databases
Interaction
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length411
- Mass (Da)46,950
- Last updated2000-10-01 v1
- Checksum8C206A6CDB39DA00
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A178V7P2 | A0A178V7P2_ARATH | AAD2 | 413 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 6 | in Ref. 4; BAD43925 | ||||
Sequence: N → S | ||||||
Sequence conflict | 174 | in Ref. 4; BAD43925 and 3; AAQ62867 | ||||
Sequence: P → S | ||||||
Sequence conflict | 218 | in Ref. 3; AAQ62867 | ||||
Sequence: S → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC021640 EMBL· GenBank· DDBJ | AAF32468.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE73839.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT010447 EMBL· GenBank· DDBJ | AAQ62867.1 EMBL· GenBank· DDBJ | mRNA | ||
AK176162 EMBL· GenBank· DDBJ | BAD43925.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |