Q9M3V8 · RS6_ASPOF
- ProteinSmall ribosomal subunit protein eS6
- Generps6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids251 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Component of the 40S small ribosomal subunit (By similarity).
Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA (By similarity).
Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ribonucleoprotein complex | |
Cellular Component | ribosome | |
Molecular Function | structural constituent of ribosome | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein eS6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Asparagales > Asparagaceae > Asparagoideae > Asparagus
Accessions
- Primary accessionQ9M3V8
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000137331 | 1-251 | Small ribosomal subunit protein eS6 | |||
Sequence: MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKTCSKAPKIQRLVTPLTLQRKRARIAEKKKRVAKAKSEAAEYQKLLASRLKEQRDRRSESLAKKRSRLSAAAAKTASVSA |
Post-translational modification
Ribosomal protein S6 is the major substrate of protein kinases in eukaryote ribosomes.
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 218-235 | Basic and acidic residues | ||||
Sequence: ASRLKEQRDRRSESLAKK | ||||||
Region | 218-251 | Disordered | ||||
Sequence: ASRLKEQRDRRSESLAKKRSRLSAAAAKTASVSA |
Sequence similarities
Belongs to the eukaryotic ribosomal protein eS6 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length251
- Mass (Da)28,471
- Last updated2000-10-01 v1
- ChecksumE75E79D419B2C5D7
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 218-235 | Basic and acidic residues | ||||
Sequence: ASRLKEQRDRRSESLAKK |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ277533 EMBL· GenBank· DDBJ | CAB89081.1 EMBL· GenBank· DDBJ | mRNA |