Q9M1X0 · RRFC_ARATH
- ProteinRibosome-recycling factor, chloroplastic
- GeneRRF
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids275 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Responsible for the release of ribosomes from messenger RNA at the termination of chloroplastic protein biosynthesis.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Cellular Component | cytosol | |
Cellular Component | thylakoid | |
Molecular Function | copper ion binding | |
Biological Process | chloroplast organization | |
Biological Process | defense response to fungus | |
Biological Process | embryo development ending in seed dormancy | |
Biological Process | plastid translation |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRibosome-recycling factor, chloroplastic
- Short namesRRF
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M1X0
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-82 | Chloroplast | ||||
Sequence: MAASFSSTAPTTPVLRFRANYSKPLLSLPDSCLRIISSAISPSTRLIACSFKTDKLPLGAGVNLSGGPVVKRSLQKRLVIRS | ||||||
Chain | PRO_0000282651 | 83-275 | Ribosome-recycling factor, chloroplastic | |||
Sequence: ATIEEIEAEKSAIETDVKSKMEKTIETLRTSFNSIRTGRSNAAMLDKIEVEYYGSPVSLKSIAQISTPDGSSLLLQPYDKSSLKAIEKAIVNSDLGVTPNNDGDVIRLSLPPLTSDRRKELSKVVAKQSEEGKVALRNIRRDALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQKEKELMKV |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 215-271 | |||||
Sequence: KVALRNIRRDALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQKEKE |
Sequence similarities
Belongs to the RRF family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length275
- Mass (Da)30,422
- Last updated2002-07-26 v2
- ChecksumF8A01D363C3979D8
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL138648 EMBL· GenBank· DDBJ | CAB86420.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE80446.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF372883 EMBL· GenBank· DDBJ | AAK49599.1 EMBL· GenBank· DDBJ | mRNA | ||
AY056778 EMBL· GenBank· DDBJ | AAL09724.1 EMBL· GenBank· DDBJ | mRNA | ||
AY092982 EMBL· GenBank· DDBJ | AAM12981.1 EMBL· GenBank· DDBJ | mRNA | ||
BT002678 EMBL· GenBank· DDBJ | AAO11594.1 EMBL· GenBank· DDBJ | mRNA |