Q9M1U4 · TCP16_ARATH
- ProteinTranscription factor TCP16
- GeneTCP16
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids165 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required during early processes in pollen development.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor TCP16
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M1U4
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000330790 | 1-165 | Transcription factor TCP16 | |||
Sequence: MDSKNGINNSQKARRTPKDRHLKIGGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWLLQNAEPAIFAATGHGVTTTSNEDIQPNRNFPSYTFNGDNISNNVFPCTVVNTGHRQMVFPVSTMTDHAPSTNYSTISDNYNSTFNGNATASDTTSAATTTATTTV |
Proteomic databases
Expression
Tissue specificity
Mostly in anther in young buds.
Developmental stage
Expressed in developing microspores during pollen development. First observed at the tetrad stage, and later accumulates in an early unicellular stage. Levels decrease as the pollen grain matures.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9M1U4 | At2g02060 Q7X887 | 3 | EBI-15198627, EBI-15196671 | |
BINARY | Q9M1U4 | BBX23 O82617 | 3 | EBI-15198627, EBI-15191793 | |
BINARY | Q9M1U4 | BZR1 Q8S307 | 3 | EBI-15198627, EBI-1803261 | |
BINARY | Q9M1U4 | ERF4 O80340 | 5 | EBI-15198627, EBI-966009 | |
BINARY | Q9M1U4 | ERF8 Q9MAI5 | 3 | EBI-15198627, EBI-2000137 | |
BINARY | Q9M1U4 | ERF9 Q9FE67 | 3 | EBI-15198627, EBI-4431933 | |
BINARY | Q9M1U4 | IAA15 A0A2H1ZEF6 | 3 | EBI-15198627, EBI-25524519 | |
BINARY | Q9M1U4 | IAA17 P93830 | 6 | EBI-15198627, EBI-632243 | |
BINARY | Q9M1U4 | IAA20 O24410 | 3 | EBI-15198627, EBI-632272 | |
BINARY | Q9M1U4 | IAA9 Q38827 | 3 | EBI-15198627, EBI-632216 | |
BINARY | Q9M1U4 | NIMIN-2 Q9LUA3 | 3 | EBI-15198627, EBI-541107 | |
BINARY | Q9M1U4 | NIMIN-3 Q9FNZ4 | 3 | EBI-15198627, EBI-541115 | |
BINARY | Q9M1U4 | WOX4 Q6X7J9 | 3 | EBI-15198627, EBI-4459694 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Disordered | ||||
Sequence: MDSKNGINNSQKARRTPKDRH | ||||||
Domain | 17-71 | TCP | ||||
Sequence: PKDRHLKIGGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWLLQNAEPAIFAA | ||||||
Region | 146-165 | Disordered | ||||
Sequence: GNATASDTTSAATTTATTTV |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length165
- Mass (Da)17,998
- Last updated2000-10-01 v1
- Checksum36C9282656187FDF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL138649 EMBL· GenBank· DDBJ | CAB72153.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE77998.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DR751441 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
DR751442 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |