Q9M1J7 · SSL8_ARATH
- ProteinProtein STRICTOSIDINE SYNTHASE-LIKE 8
- GeneSSL8
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids376 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | vacuole | |
Biological Process | biosynthetic process |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein STRICTOSIDINE SYNTHASE-LIKE 8
- Short namesAtSSL8
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M1J7
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-31 | |||||
Sequence: MPISRRVLTPITAAPVILAVLCFFFWSSIIG | ||||||
Chain | PRO_0000431595 | 32-376 | Protein STRICTOSIDINE SYNTHASE-LIKE 8 | |||
Sequence: PDNLKGTKHVLQDAKTIPLPVDGPESLEFDPQGEGPYVGVTDGRILKWRGEELGWVDFAYTSPHRDNCSSHEVVPSCGRPLGLSFERKTGDLYICDGYFGVMKVGPEGGLAELVVDEAEGRKVMFANQGDIDEEEDIFYFNDSSDTYHFRDVFYVSLSGTKVGRVIRYDMKKKEAKVIMDKLRLPNGLALSKNGSFVVTCESSTNICHRIWVKGPKSGTNEVFATLPGSPDNIRRTPTGDFWVALHCKKNLFTRAVLIHTWVGRFFMNTMKMETVIHFMNGGKPHGIVVKLSGETGEILEILEDSEGKTVKYVSEAYETKDGKLWIGSVYWPAVWVLDTSVYDSI | ||||||
Glycosylation | 98 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 172 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 224 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length376
- Mass (Da)41,980
- Last updated2000-10-01 v1
- Checksum87FD39FAFF426543
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 142 | in Ref. 3; AAK43996 | ||||
Sequence: A → G | ||||||
Sequence conflict | 237 | in Ref. 4; CAB69786 | ||||
Sequence: I → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL138655 EMBL· GenBank· DDBJ | CAB72171.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE79598.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF370181 EMBL· GenBank· DDBJ | AAK43996.1 EMBL· GenBank· DDBJ | mRNA | ||
AY142495 EMBL· GenBank· DDBJ | AAN13046.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ271473 EMBL· GenBank· DDBJ | CAB69786.1 EMBL· GenBank· DDBJ | mRNA |