Q9M1C2 · CH101_ARATH
- Protein10 kDa chaperonin 1, chloroplastic
- GeneCPN10-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids138 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Functions as a co-chaperone for protein folding in chloroplasts.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | protein folding chaperone |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended name10 kDa chaperonin 1, chloroplastic
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9M1C2
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-61 | Chloroplast | ||||
Sequence: MASSFITVPKPFLSFPIKTNAPTLPQQTLLGIRRNSFRINAVSTKWEPAKVVPQADRVLVR | ||||||
Chain | PRO_0000438193 | 62-138 | 10 kDa chaperonin 1, chloroplastic | |||
Sequence: LEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGKKVLFSDMSAYEVDFGTEDAKHCFCKESDLLAIVQ |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at low levels in germinating seeds, seedlings, rosettes leaves, flowers and siliques.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 50-137 | Cpn-10 domain | ||||
Sequence: KVVPQADRVLVRLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGKKVLFSDMSAYEVDFGTEDAKHCFCKESDLLAIV |
Sequence similarities
Belongs to the GroES chaperonin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length138
- Mass (Da)15,141
- Last updated2000-10-01 v1
- Checksum9D3FBB02DFFEF495
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL138658 EMBL· GenBank· DDBJ | CAB75936.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE80024.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT005842 EMBL· GenBank· DDBJ | AAO64777.1 EMBL· GenBank· DDBJ | mRNA | ||
AK228307 EMBL· GenBank· DDBJ | BAF00250.1 EMBL· GenBank· DDBJ | mRNA | ||
AY087462 EMBL· GenBank· DDBJ | AAM65007.1 EMBL· GenBank· DDBJ | mRNA |