Q9LZ78 · SIM_ARATH
- ProteinCyclin-dependent protein kinase inhibitor SIM
- GeneSIM
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids127 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967).
Inhibits the kinase activity of CYCD3-1/CDKA-1, CYCD2-1/CDKA-1 and CYCB1-1/CDKB1-1 complexes in a dose dependent manner (PubMed:26546445).
Cooperates with SMR1 and SMR2 to promote endoreplication during leaf development (PubMed:26546445).
Required for normal trichome endoreplicating cell cycles (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967).
Positive regulator of effector-triggered immunity (ETI) (PubMed:25455564).
Inhibits the kinase activity of CYCD3-1/CDKA-1, CYCD2-1/CDKA-1 and CYCB1-1/CDKB1-1 complexes in a dose dependent manner (PubMed:26546445).
Cooperates with SMR1 and SMR2 to promote endoreplication during leaf development (PubMed:26546445).
Required for normal trichome endoreplicating cell cycles (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967).
Positive regulator of effector-triggered immunity (ETI) (PubMed:25455564).
Miscellaneous
Plants over-expressing SIM are dwarf with serrated leaves containing enlarged cells with increased levels of nuclear DNA.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | cyclin-dependent protein serine/threonine kinase inhibitor activity | |
Biological Process | DNA endoreduplication | |
Biological Process | negative regulation of cell cycle | |
Biological Process | negative regulation of cyclin-dependent protein serine/threonine kinase activity | |
Biological Process | negative regulation of mitotic nuclear division | |
Biological Process | regulation of DNA endoreduplication | |
Biological Process | trichome differentiation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCyclin-dependent protein kinase inhibitor SIM
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LZ78
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Multicellular trichomes with nuclei showing reduced levels of endoreduplication.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000418063 | 1-127 | Cyclin-dependent protein kinase inhibitor SIM | |||
Sequence: MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRSFRSCSRR |
Proteomic databases
Expression
Tissue specificity
Expressed in the shoot apical meristem, leaf primordia and the elongation zone of the root.
Induction
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 21-71 | Disordered | ||||
Sequence: RANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRS | ||||||
Compositional bias | 28-45 | Polar residues | ||||
Sequence: DDGGGCTTPTSSDHKIPP | ||||||
Compositional bias | 46-62 | Pro residues | ||||
Sequence: TTATTPPPPPQKPRPPS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length127
- Mass (Da)14,091
- Last updated2000-10-01 v1
- Checksum3CD095F760CBE781
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 28-45 | Polar residues | ||||
Sequence: DDGGGCTTPTSSDHKIPP | ||||||
Compositional bias | 46-62 | Pro residues | ||||
Sequence: TTATTPPPPPQKPRPPS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL162875 EMBL· GenBank· DDBJ | CAB85553.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED90749.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT009698 EMBL· GenBank· DDBJ | AAP88332.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085204 EMBL· GenBank· DDBJ | AAM61754.1 EMBL· GenBank· DDBJ | mRNA | ||
AK175850 EMBL· GenBank· DDBJ | BAD43613.1 EMBL· GenBank· DDBJ | mRNA |