Q9LVM2 · NDHN_ARATH
- ProteinNAD(P)H-quinone oxidoreductase subunit N, chloroplastic
- GenendhN
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids209 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.
Catalytic activity
- a plastoquinone + (n+1) H+(in) + NADH = a plastoquinol + n H+(out) + NAD+
a plastoquinone RHEA-COMP:9562 + (n+1) H+ (in)CHEBI:15378+ CHEBI:57945 = a plastoquinol RHEA-COMP:9561 + n H+ (out)CHEBI:15378+ CHEBI:57540 - a plastoquinone + (n+1) H+(in) + NADPH = a plastoquinol + n H+(out) + NADP+
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | NAD(P)H dehydrogenase complex (plastoquinone) | |
Cellular Component | plastid | |
Molecular Function | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor | |
Molecular Function | quinone binding | |
Biological Process | defense response to fungus | |
Biological Process | NADH dehydrogenase complex (plastoquinone) assembly |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameNAD(P)H-quinone oxidoreductase subunit N, chloroplastic
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LVM2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Malfunction of the NDH complex.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 11 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-45 | Chloroplast | ||||
Sequence: MGSRAICIQRVAPPCFEASQVKKIKTVGSFLVNTRSKRRRSTGVK | ||||||
Chain | PRO_0000431814 | 46-209 | NAD(P)H-quinone oxidoreductase subunit N, chloroplastic | |||
Sequence: CSSIADYIGGDLVKPDIGQWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKMQGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLAALPPSAKGLVVWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIANLAAQE |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Part of the chloroplast NDH complex, composed of a mixture of chloroplast and nucleus encoded subunits. Component of the NDH subcomplex A, at least composed of ndhH, ndhI, ndhJ, ndhK, ndhL, ndhM, ndhN and ndhO.
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q9LVM2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length209
- Mass (Da)23,398
- Last updated2000-10-01 v1
- ChecksumA8A621C6CA7B97D7
Q9LVM2-2
- Name2
- NoteMay be due to intron retention.
- Differences from canonical
- 164-209: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_057441 | 164-209 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB019228 EMBL· GenBank· DDBJ | BAA96917.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED97025.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED97026.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY080743 EMBL· GenBank· DDBJ | AAL85990.1 EMBL· GenBank· DDBJ | mRNA | ||
AY113999 EMBL· GenBank· DDBJ | AAM45047.1 EMBL· GenBank· DDBJ | mRNA | ||
AK318705 EMBL· GenBank· DDBJ | BAH56820.1 EMBL· GenBank· DDBJ | mRNA |