Q9LVI9 · DPYD_ARATH
- ProteinDihydropyrimidine dehydrogenase (NADP(+)), chloroplastic
- GenePYD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids426 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in pyrimidine base degradation. Catalyzes the reduction of uracil to 5,6-dihydrouracil (DHU) by using NADH as a specific cosubstrate and the reduction of thymine to 5,6-dihydrothymine (DHT). Involved in the recycling of nitrogen from nucleobases to general nitrogen metabolism.
Catalytic activity
- 5,6-dihydrouracil + NADP+ = H+ + NADPH + uracil
Pathway
Amino-acid biosynthesis; beta-alanine biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 129 | substrate | ||||
Sequence: N | ||||||
Binding site | 188-190 | substrate | ||||
Sequence: NFS | ||||||
Active site | 191 | Nucleophile | ||||
Sequence: C | ||||||
Binding site | 256-257 | substrate | ||||
Sequence: NT |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Cellular Component | plastid | |
Molecular Function | dihydropyrimidine dehydrogenase (NADP+) activity | |
Biological Process | beta-alanine biosynthetic process | |
Biological Process | cellular response to nitrogen levels | |
Biological Process | uracil catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDihydropyrimidine dehydrogenase (NADP(+)), chloroplastic
- EC number
- Short namesDHPDH ; DPD
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LVI9
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype, but impaired degradation of both thymine and uracil (PubMed:19413687, PubMed:21865177).
Slower germination and 2 days delay in seedling development (PubMed:21865177).
Slower germination and 2 days delay in seedling development (PubMed:21865177).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 23 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-44 | Chloroplast | ||||
Sequence: MASMSFALNRFSGLSSKTTLSADFDPSSRRSFLPPTRVGLKISS | ||||||
Modified residue | 45 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000432454 | 45-426 | Dihydropyrimidine dehydrogenase (NADP+), chloroplastic | |||
Sequence: AAESEPDLSVTVNGLKMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAKTVSLDASKVINVTPRYARLRTGSNGSAKTDVIGWQNIELISDRPLETMLKEFERLKKEYPDRILIASVMEEYNKTAWEELIDRVEQTGVDALEINFSCPHGMPERRMGAAVGQDCALLDEVCGWINAKATVPVWAKMTPNITDITEPARVSLKSGCEGIAAINTIMSVMGIDMKTLRPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAKMMKSEFSEDRSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELKDFMKQHNFSTIEEFRGHSLQYFTTHTDLVKRQKEAVEQRKAEKRGLKSDKDWTGDGFVKETESMVSN |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in roots, leaves, stems, siliques and flowers. Highly expressed ion dry seeds.
Induction
Up-regulated by nitrogen limitation.
Developmental stage
Up-regulated at days 4 and 5 after germination and during senescence.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 395-414 | Disordered | ||||
Sequence: VEQRKAEKRGLKSDKDWTGD |
Sequence similarities
Belongs to the dihydropyrimidine dehydrogenase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length426
- Mass (Da)46,847
- Last updated2000-10-01 v1
- Checksum0DA1BAEE08F90A18
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF545062 EMBL· GenBank· DDBJ | AAN64919.1 EMBL· GenBank· DDBJ | mRNA | ||
AB019230 EMBL· GenBank· DDBJ | BAB02704.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE76010.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY035029 EMBL· GenBank· DDBJ | AAK59534.1 EMBL· GenBank· DDBJ | mRNA | ||
AY059103 EMBL· GenBank· DDBJ | AAL15209.1 EMBL· GenBank· DDBJ | mRNA |