Q9LV16 · B3GTJ_ARATH
- ProteinHydroxyproline O-galactosyltransferase GALT6
- GeneGALT6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids681 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Possesses hydroxyproline O-galactosyltransferase activity. Transfers galactose from UDP-galactose to hydroxyproline residues in the arabinogalactan proteins (AGPs). Is specific for AGPs containing non-contiguous peptidyl hydroxyproline residues. Utilizes UDP-galactose solely as sugar donor. The addition of galactose onto the peptidyl hydroxyproline residues in AGP core proteins represents the first committed step in arabinogalactan polysaccharide addition. AGP glycans play essential roles in both vegetative and reproductive plant growth.
Cofactor
Pathway
Protein modification; protein glycosylation.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Molecular Function | carbohydrate binding | |
Molecular Function | hydroxyproline O-galactosyltransferase activity | |
Biological Process | arabinogalactan protein metabolic process | |
Biological Process | mucilage biosynthetic process involved in seed coat development | |
Biological Process | negative regulation of leaf senescence | |
Biological Process | protein O-linked glycosylation via hydroxyproline |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameHydroxyproline O-galactosyltransferase GALT6
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LV16
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-28 | Cytoplasmic | ||||
Sequence: MRKPKLSKLERLEKFDIFVSLSKQRSVQ | ||||||
Transmembrane | 29-49 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: ILMAVGLLYMLLITFEIPFVF | ||||||
Topological domain | 50-681 | Lumenal | ||||
Sequence: KTGLSSLSQDPLTRPEKHNSQRELQERRAPTRPLKSLLYQESQSESPAQGLRRRTRILSSLRFDPETFNPSSKDGSVELHKSAKVAWEVGRKIWEELESGKTLKALEKEKKKKIEEHGTNSCSLSVSLTGSDLLKRGNIMELPCGLTLGSHITVVGKPRAAHSEKDPKISMLKEGDEAVKVSQFKLELQGLKAVEGEEPPRILHLNPRLKGDWSGKPVIEQNTCYRMQWGSAQRCEGWRSRDDEETVDGQVKCEKWARDDSITSKEEESSKAASWWLSRLIGRSKKVTVEWPFPFTVDKLFVLTLSAGLEGYHVSVDGKHVTSFPYRTGFTLEDATGLTINGDIDVHSVFAGSLPTSHPSFSPQRHLELSSNWQAPSLPDEQVDMFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARFFVALHSRKEVNVELKKEAEFFGDIVIVPYMDSYDLVVLKTVAICEYGAHQLAAKFIMKCDDDTFVQVDAVLSEAKKTPTDRSLYIGNINYYHKPLRQGKWSVTYEEWPEEDYPPYANGPGYILSNDISRFIVKEFEKHKLRMFKMEDVSVGMWVEQFNNGTKPVDYIHSLRFCQFGCIENYLTAHYQSPRQMICLWDKLVLTGKPQCCNMR |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduced levels of arabinogalactan proteins. Root hair defects. Reduced seed sets. Reduced seed coat mucilage. Increased sensitivity to salt stress. Premature senescence.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000359429 | 1-681 | Hydroxyproline O-galactosyltransferase GALT6 | |||
Sequence: MRKPKLSKLERLEKFDIFVSLSKQRSVQILMAVGLLYMLLITFEIPFVFKTGLSSLSQDPLTRPEKHNSQRELQERRAPTRPLKSLLYQESQSESPAQGLRRRTRILSSLRFDPETFNPSSKDGSVELHKSAKVAWEVGRKIWEELESGKTLKALEKEKKKKIEEHGTNSCSLSVSLTGSDLLKRGNIMELPCGLTLGSHITVVGKPRAAHSEKDPKISMLKEGDEAVKVSQFKLELQGLKAVEGEEPPRILHLNPRLKGDWSGKPVIEQNTCYRMQWGSAQRCEGWRSRDDEETVDGQVKCEKWARDDSITSKEEESSKAASWWLSRLIGRSKKVTVEWPFPFTVDKLFVLTLSAGLEGYHVSVDGKHVTSFPYRTGFTLEDATGLTINGDIDVHSVFAGSLPTSHPSFSPQRHLELSSNWQAPSLPDEQVDMFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARFFVALHSRKEVNVELKKEAEFFGDIVIVPYMDSYDLVVLKTVAICEYGAHQLAAKFIMKCDDDTFVQVDAVLSEAKKTPTDRSLYIGNINYYHKPLRQGKWSVTYEEWPEEDYPPYANGPGYILSNDISRFIVKEFEKHKLRMFKMEDVSVGMWVEQFNNGTKPVDYIHSLRFCQFGCIENYLTAHYQSPRQMICLWDKLVLTGKPQCCNMR | ||||||
Glycosylation | 629 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in junveile leaves and stems, and at lower levels in cauline leaves and siliques.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 57-80 | Disordered | ||||
Sequence: SQDPLTRPEKHNSQRELQERRAPT | ||||||
Compositional bias | 64-79 | Basic and acidic residues | ||||
Sequence: PEKHNSQRELQERRAP | ||||||
Domain | 187-401 | Galectin | ||||
Sequence: NIMELPCGLTLGSHITVVGKPRAAHSEKDPKISMLKEGDEAVKVSQFKLELQGLKAVEGEEPPRILHLNPRLKGDWSGKPVIEQNTCYRMQWGSAQRCEGWRSRDDEETVDGQVKCEKWARDDSITSKEEESSKAASWWLSRLIGRSKKVTVEWPFPFTVDKLFVLTLSAGLEGYHVSVDGKHVTSFPYRTGFTLEDATGLTINGDIDVHSVFAG |
Sequence similarities
Belongs to the glycosyltransferase 31 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
Q9LV16-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length681
- Mass (Da)77,741
- Last updated2009-01-20 v2
- Checksum096DB0745ECDDE0B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B3H4Y4 | B3H4Y4_ARATH | GALT6 | 612 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 64-79 | Basic and acidic residues | ||||
Sequence: PEKHNSQRELQERRAP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KJ138629 EMBL· GenBank· DDBJ | AHL38569.1 EMBL· GenBank· DDBJ | mRNA | ||
AB020751 EMBL· GenBank· DDBJ | BAA97209.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED97631.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX831498 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |